KEGG   Shewanella sp. MR-7: Shewmr7_0016Help
Entry
Shewmr7_0016      CDS       T00389                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / short chain enoyl-CoA hydratase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00071  Fatty acid degradation
shm00280  Valine, leucine and isoleucine degradation
shm00281  Geraniol degradation
shm00310  Lysine degradation
shm00362  Benzoate degradation
shm00380  Tryptophan metabolism
shm00410  beta-Alanine metabolism
shm00640  Propanoate metabolism
shm00650  Butanoate metabolism
shm00903  Limonene and pinene degradation
shm00930  Caprolactam degradation
shm01040  Biosynthesis of unsaturated fatty acids
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01120  Microbial metabolism in diverse environments
shm01130  Biosynthesis of antibiotics
shm01200  Carbon metabolism
shm01212  Fatty acid metabolism
Module
shm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Shewmr7_0016
   00650 Butanoate metabolism
    Shewmr7_0016
  Lipid metabolism
   00071 Fatty acid degradation
    Shewmr7_0016
   01040 Biosynthesis of unsaturated fatty acids
    Shewmr7_0016
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shewmr7_0016
   00310 Lysine degradation
    Shewmr7_0016
   00380 Tryptophan metabolism
    Shewmr7_0016
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Shewmr7_0016
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Shewmr7_0016
   00281 Geraniol degradation
    Shewmr7_0016
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Shewmr7_0016
   00930 Caprolactam degradation
    Shewmr7_0016
Enzymes [BR:shm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Shewmr7_0016
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Shewmr7_0016
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Shewmr7_0016
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Shewmr7_0016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABI41022
UniProt: Q0I0T3
Position
complement(19875..22025)
Genome map
AA seq 716 aa AA seqDB search
MIYQSPTIQVELLEDNIAKLCFNAPGSVNKFDRETLASLDAALDSIKQQSNIQALVLTSG
KDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCET
ILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWITTGKDQRPEDALK
VGAVDAVVAPEALEAAAIQMLKDAVAEKLDWQARRHRKMSPLTLPKLEAMMSFTTAKGMV
FAVAGKHYPAPMAAVSVVEQAATKGRSDALQIEHQAFIKLAKTDVAKALIGIFLNDQLVK
GKAKKAGKLAKDVKSAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLGEAAKLL
SAQVARGRSTPEKMAKVLNNITPALDYAPVNHADVVVEAVVEHPKVKAQVLAEVEQYVSE
DAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGPAYL
LDVVGLDTGHHAQAVMAEGFPDRMGKSGNDAIDVMFENKRLGQKNGKGFYAYSVDSRGKP
KKDVDPTSYELLKAAFGEQKAFDADEIIARTMIPMIIETVRCLEEGIVASPAEADMGLVY
GLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRALAANNGSYYQA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaagtcctacaattcaggttgagttactcgaggataatattgccaagctg
tgctttaacgcacccggttcggtgaacaaattcgacagagaaacactcgcctcactcgat
gccgcattagatagcattaaacaacaatcaaacattcaggctttagtgctgacctcaggt
aaagatacctttatcgtgggtgccgacattactgaatttttaggcttattcgcacaggat
gatgcggtactgctctcttgggttgaacaggccaacgccgtattcaacaaactcgaagat
ttacctttcccaaccgcttcagcgattaaaggtttcgccctaggcggcggttgtgaaact
attctggcaacggatttccgtatcgccgacaccacagccaaaatcggcctgcccgaaacc
aaactgggcattatcccaggctttggtggcacagtgcgtttaccacgtgtgattggtgcg
gataacgcccttgagtggatcaccacgggtaaagatcagcgtccagaagatgccttaaaa
gtcggtgcggttgatgctgttgtcgcgccagaggctttagaagccgccgccattcaaatg
ctaaaagatgcagttgcagaaaagcttgattggcaagcccgtcgccaccgtaagatgtca
ccactgaccctaccaaaactcgaagccatgatgtctttcactaccgctaaaggcatggtg
tttgcggttgcgggtaaacactacccagcaccaatggcggcagtcagcgtagttgaacaa
gcggcgaccaaaggccgcagcgacgcactgcaaattgaacatcaagcgtttatcaagtta
gcgaaaaccgatgttgccaaggcgttgatcggtatcttcttgaatgaccaattagtcaaa
ggcaaggccaagaaagcgggcaaactcgccaaagatgtgaaaagcgccgccgtattaggt
gctggcatcatgggtggcggtatcgcttaccaaagcgccagcaaaggcacgccaatcgtg
atgaaggatatcgctcaacctgcattagatttaggtttaggcgaagccgctaaactgtta
tctgcacaagttgctcgcggccgctctaccccagaaaaaatggctaaggtgctgaacaac
atcactccagccttagactatgctccagttaaccatgctgacgtggttgtcgaagccgta
gttgagcatccaaaagtgaaggcacaagtactggctgaagtagagcaatacgtgagtgaa
gatgcgattatcgcctctaacacgtcaactatttcaatcaacctgctcgcgaagagcatg
aagaagcctgagcgtttctgcggtatgcacttcttcaacccagtgcacaaaatgccattg
gttgaagttattcgtggcgagcacagctcagaagaaaccatcgcatctgttgttgcctac
gccagcaaaatgggtaaaaccccaatcgttgttaacgattgcccgggtttcttcgttaac
cgcgtactcttcccttactttgcgggctttaacggcctgctcgccgaaggtggcgacttt
gccgctatcgataaagtgatggaaaaacaattcggctggccaatgggtcctgcttacctg
ctagacgttgtcggcctagacacgggtcaccacgcgcaagcggtaatggccgaaggcttc
cccgatcgtatgggcaaatctggcaatgacgcgattgacgtgatgtttgagaacaagcgt
ctcggtcagaagaatggtaaaggtttctacgcttactctgtagatagccgtggtaaacca
aagaaagatgtcgacccaaccagctacgagctgctgaaggccgcctttggtgagcaaaaa
gcattcgatgcggatgaaatcatcgcccgcactatgatcccaatgattatcgaaaccgtt
cgctgtttagaagaaggcattgtggcatcacctgccgaagcggatatgggcttggtatat
ggtttaggtttccctccattccgtggtggtgtattccgttacttagatactatgggcgta
gcgaactttgtcgccttagctgataaatacgctcacttaggtggtttgtatcaagtcacc
gacgccatgcgcgcccttgcagccaacaacggtagctactaccaagcctaa

DBGET integrated database retrieval system