KEGG   Shewanella sp. MR-7: Shewmr7_0222
Entry
Shewmr7_0222      CDS       T00389                                 

Definition
(GenBank) CcmE/CycJ protein
  KO
K02197  cytochrome c-type biogenesis protein CcmE
Organism
shm  Shewanella sp. MR-7
Brite
KEGG Orthology (KO) [BR:shm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    Shewmr7_0222
SSDB
Motif
Pfam: CcmE DUF4345
Other DBs
NCBI-ProteinID: ABI41227
UniProt: Q0I078
Position
complement(239841..240326)
AA seq 161 aa
MNPRRKKRLTLAIALIGGVAAIASLLLYALNSNLNLFYTPSEIVNGKADTGVKPEAGQRI
RVGGMVTVGSMVRDPNSLHVQFAVHDSLGGEIMVTYDDLLPDLFREGQGIVAQGVLGEDG
KLAATEVLAKHDENYMPPEVAEAMGQKHEKLDYSQQKSAAQ
NT seq 486 nt   +upstreamnt  +downstreamnt
gtgaacccaagacgcaaaaagagactgacgttagccattgcattgatcggtggcgtagcc
gcgattgcttcgctactgctgtatgcgctgaactccaacttgaacttattctataccccg
tctgaaatcgttaacggtaaggccgacaccggcgttaaacccgaagcgggtcagcgtatt
cgtgtgggcggcatggtaacggtcggctctatggtgcgcgatccaaacagcctgcatgta
cagtttgccgttcacgattcattaggcggcgaaatcatggtgacctacgacgatctgctg
cctgatctcttccgtgaaggacaaggtatcgtggcacaaggcgtactaggtgaagatggc
aagctggccgcgaccgaagttctggctaagcacgatgaaaactacatgccgccagaagta
gcagaggccatgggccaaaaacatgagaagcttgattacagccagcagaaatcggcagcg
caataa

DBGET integrated database retrieval system