KEGG   Shewanella sp. MR-7: Shewmr7_0330Help
Entry
Shewmr7_0330      CDS       T00389                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00230  Purine metabolism
shm01100  Metabolic pathways
Module
shm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Shewmr7_0330
Enzymes [BR:shm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Shewmr7_0330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 MMR_HSR1 RsgA_GTPase AAA_33 AAA_22 AAA_29 ABC_tran ATP-synt_ab cobW AAA_23
Motif
Other DBs
NCBI-ProteinID: ABI41334
UniProt: Q0HZX1
Position
complement(364731..365405)
Genome map
AA seq 224 aa AA seqDB search
MLGFLGPSCVNQLDILLMTARGNLFIVSAPSGAGKSSLISALLKDKPADMQVSVSHTTRA
PRPGEVNGQHYHFVNVEEFKALIEQNAFFEWAEVFGNYYGTSRHVIEHTLTQGIDVFLDI
DWQGAQQVKAVMPEAIGVFILPPSRDELERRLTGRGQDSQEVIASRMAQAVSEMSHYKEY
DFIIVNDDFDTALADLRAIIRSQRLTGASQIHAQNDMLNDLLAG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgctcggctttctgggcccttcttgcgttaaccaactggatattttgctcatgaccgca
cgcggaaatttatttattgtttcagccccgagtggtgctggtaaatcctcgctgatttcg
gcgctgctgaaagacaaacccgccgacatgcaggtttcagtgtcgcacactacccgtgcg
cctcgccctggcgaagtgaatggtcagcactaccattttgttaatgttgaagaatttaaa
gcactgatcgagcaaaatgcctttttcgagtgggccgaagtgttcggtaactactatggc
acttcacgccacgtcattgagcacactttgactcaaggtatcgatgttttcctcgatatc
gactggcaaggcgctcagcaagtcaaagccgtgatgccagaggccattggtgtatttatt
ctaccgccctcaagggatgagctagaacgtcgcctcactggccgtggccaagacagtcag
gaagttatcgccagccgtatggcacaggcggtttctgaaatgtcgcactataaagaatat
gattttattatcgtcaatgacgattttgacacagcactggccgatctgcgggcgatcatt
cgcagccaacgcttaacgggtgctagtcagatccacgcgcaaaatgatatgcttaacgat
ctgttggcaggctaa

DBGET integrated database retrieval system