KEGG   Shewanella sp. MR-7: Shewmr7_0660Help
Entry
Shewmr7_0660      CDS       T00389                                 

Definition
(GenBank) Amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00330  Arginine and proline metabolism
shm00360  Phenylalanine metabolism
shm00380  Tryptophan metabolism
shm00627  Aminobenzoate degradation
shm00643  Styrene degradation
shm01100  Metabolic pathways
shm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Shewmr7_0660
   00360 Phenylalanine metabolism
    Shewmr7_0660
   00380 Tryptophan metabolism
    Shewmr7_0660
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Shewmr7_0660
   00643 Styrene degradation
    Shewmr7_0660
Enzymes [BR:shm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     Shewmr7_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABI41663
UniProt: Q0HYZ2
Position
773661..775367
Genome map
AA seq 568 aa AA seqDB search
MFEVTEVSIAELREALESGRTTAVELVKSYLARVAAYDGPATETKLNALVVHNPDALKEA
EASDARRARGETLSPLDGIPYTAKDSYLVKGLTAASGSPAFKDLVAQYDAFAVERLRAAG
AICLGKTNMPPMANGGMQRGHYGRAESPYNANYLTAPFASGSSNGAGTGTAASYSAFGLA
EETWSSGRGPASNNGLCAYTPSRGVISVRGNWPLTPTMDVVVPYTRTMADMLEVLDVIVA
DDPITRGDLWRLQPWVQIPKASSVRPESYLALAASADTLKGKRFGVPRMYINKDELAGTS
ENPGIGGPTGQRIHTRQSVIDLWEAARKSLEAAGAEVIEVDFPLVSNCEGDRPGAPTVFN
RGIVTPQFLHDELWELSGWAFDEFLRANNDPKLNKLEDVVGHLIFPHDLGTLPNREGDLA
AGMEEYVNMAKRGLKSYDQIDSIPDGLRGLEKTRKLDLEDWMDGLKLDAVLFPTVADVGP
ADAHVNPASADIAWSNGVWVANGNLAIRHLGVPTVTVPMGVMADIGMPVGLTFAGRAYDD
NNLLKFAGAFESTGNKRMVPPRTPPLSQ
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagtaactgaagtttccattgccgagctgcgtgaagcactcgaatctggccgc
acgactgcggttgagttggtgaaatcctatttggctcgagtggcggcttacgatggccct
gccactgagactaagttgaatgcgttagtggtgcacaatcccgatgcgctcaaagaagcc
gaggcttccgatgcgcgtcgtgcccgtggcgaaaccttaagcccgctcgatggtattcct
tacaccgctaaggacagctatttagtgaagggactgacggcggcatcaggcagccctgca
tttaaagatttagtggcccagtacgatgccttcgccgtcgagcgcctacgcgctgcgggt
gctatttgcttaggcaaaaccaatatgccacccatggcgaatggcggcatgcagcgaggt
cactatggccgcgccgaaagcccctacaatgcgaattatctgactgcgccctttgcctcg
ggttcttccaacggtgcgggcactggaacggcggcaagctactcggcgttcggtcttgcc
gaagagacttggtcgagtggtcgtggccctgcgtccaacaacggtttgtgtgcctataca
ccgtctcgcggcgtgatttcggtgcgcggcaactggccattaaccccaaccatggacgtg
gtcgtgccttatacccgcactatggcggatatgctcgaagtgctggatgtgattgtggcc
gatgacccaatcacccgtggcgatctctggcgtctgcaaccttgggttcaaatccctaaa
gcttctagcgttcgcccagaatcctatctggcgctcgccgctagcgccgacacccttaag
ggtaagcgttttggcgtaccacgcatgtacatcaacaaagatgagctagctggtaccagc
gaaaacccaggtatcggtgggccaacgggacaacgcatccatactcgccaatcggtgatc
gatttgtgggaggcggcgcgtaaatccctagaagctgcaggtgcggaagtgattgaagtc
gattttccgctggtgtctaactgtgaaggcgaccgccccggcgcgccgaccgtgtttaac
cgtggcatagtcacgccccaattcctccatgatgaattatgggaactgtcgggttgggca
ttcgatgaattcctgcgggcgaacaacgaccctaaactcaacaagcttgaagatgtggtg
gggcatttgatattcccccatgacctcggcaccttgccaaaccgtgagggtgatttagcg
gctggcatggaagagtatgtcaacatggccaaacgcggcctgaaatcctatgaccagatc
gacagtattcccgatggtctgcgtggtttagagaagacccgtaagctggatctcgaagac
tggatggacggacttaagcttgatgccgtgctgttccctaccgtggccgatgtcggcccc
gccgatgcccatgtgaatccggcctcagccgatatcgcttggagcaacggggtttgggta
gcaaacggcaaccttgcgattcgccatttaggcgtgccgactgtgactgtgcctatgggc
gtaatggccgatattggcatgccagtgggattaaccttcgcgggccgtgcctacgatgat
aacaatctgctgaagtttgccggcgcgttcgagtcgacgggcaataagcgtatggttccg
ccgcgtacaccgccgctgagtcaataa

DBGET integrated database retrieval system