KEGG   Shewanella sp. MR-7: Shewmr7_0794Help
Entry
Shewmr7_0794      CDS       T00389                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00900  Terpenoid backbone biosynthesis
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Shewmr7_0794
Enzymes [BR:shm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Shewmr7_0794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C SPOR
Motif
Other DBs
NCBI-ProteinID: ABI41794
UniProt: Q0HYL1
Position
complement(906586..907440)
Genome map
AA seq 284 aa AA seqDB search
MSNEISRNWPAPAKLNLFLHINGRRADGYHELQTLFQFIDCCDLLDFRVTQTPELILHSD
MSAVVADSDNLILRAAKSLQQATGYPGGAEIWLEKRLPMGGGLGGGSSDAATTLVALNQL
WNTQLSNDELATIGLKLGADIPVFIRGFAAFAEGVGERLQAVTPTEFWYLVIAPDAHVST
AAVFQDPLLPRNTPKLGIDTLMSQPWANDCQDLVVSKYPQVAKALGWLLEYAPSRMTGTG
ACVFGEFSSQQQALAALAKLPSDMQGFVAKGMNISPLIVRLNHP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgagatttcacgcaattggcccgcgcccgcaaaattaaatctgtttttgcat
atcaacgggcgccgcgccgacggttaccatgagttgcaaaccctgtttcaatttatcgat
tgttgcgatctgctcgactttagggtgacgcagacgccagagctgatattgcactcggac
atgtcggccgttgtcgcggatagcgataacttaattctgcgagccgcaaaatcattacag
caagcaacaggctatcccggcggcgccgaaatctggcttgaaaaacgtttacctatgggc
ggcggtttaggcggcggttcctccgatgcggccactacactcgtggcgttaaatcagttg
tggaacacccaattatctaacgatgaattagccacaattggtttaaaactcggtgccgat
atccctgtttttattcgcggtttcgcggcatttgccgaaggcgttggcgaacgtttacag
gcggtgacgcccactgaattttggtatttagtgatagcgcccgatgcccatgtttccacc
gcagctgtgttccaagatcctttgctaccccgcaatacacctaagcttggcatcgacacg
ttaatgagccaaccttgggcaaatgattgccaagatctggtcgtttccaaataccctcaa
gttgccaaggccttaggctggctgttagaatatgcgccgtcgagaatgaccggaacgggc
gcatgcgtgtttggggagttttcttcgcagcagcaagctctcgcagccttggcgaaatta
ccgtctgatatgcaaggatttgttgcaaaagggatgaatatttcgccgctcatagtgcga
ctcaatcatccataa

DBGET integrated database retrieval system