KEGG   Shewanella sp. MR-7: Shewmr7_1087Help
Entry
Shewmr7_1087      CDS       T00389                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00010  Glycolysis / Gluconeogenesis
shm00051  Fructose and mannose metabolism
shm00562  Inositol phosphate metabolism
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01120  Microbial metabolism in diverse environments
shm01130  Biosynthesis of antibiotics
shm01200  Carbon metabolism
shm01230  Biosynthesis of amino acids
Module
shm_M00002  Glycolysis, core module involving three-carbon compounds
shm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewmr7_1087
   00051 Fructose and mannose metabolism
    Shewmr7_1087
   00562 Inositol phosphate metabolism
    Shewmr7_1087
Enzymes [BR:shm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Shewmr7_1087
Exosome [BR:shm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Shewmr7_1087
  Exosomal proteins of bladder cancer cells
   Shewmr7_1087
  Exosomal proteins of melanoma cells
   Shewmr7_1087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABI42086
UniProt: Q0HXR9
Position
1253412..1254194
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAALAQELFKKFASKLQNDSAEVVLCPPSIYLESVRQLLEANKE
ALDGSLVRMGAQNLSQHDFGAYTGEVSGQMLKDCGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIQKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSTEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcctatggtagctggcaattggaagatgaacggcagtgcggcatta
gcacaagagttgttcaagaaatttgcctcaaagctccaaaatgattcagctgaagtggtt
ttatgcccgccttctatctatctagaaagcgtcaggcagctgctagaagcaaacaaggaa
gcgttagacggttcacttgttaggatgggcgctcagaatttaagtcaacatgactttggc
gcttataccggagaagtttcgggtcagatgcttaaagattgcggatgtcgatatgtgatt
atcgggcattcagaacgtcgccgtatgtacggagagacgagtaatatcgtagcggagaaa
ttcgccgctgcacaaaagcacggtttaacccccattttatgtgtgggtgagtctggtcca
gcacgtgaagcaagacgtaccttcgaggtgattgcggaagagttggatatagtgatccag
aaaaatggcactatggcttttgataacgccattatcgcttacgagccgttatgggccgta
gggactggtaagagcgcgacaccagagcaggcacaagaagtacatgcgtttatacgcaag
cgtctctctgaagtgtctccgtttatcggagaaaatatcaggatcttgtacggtggcagt
gtgacaccgagtaatgcggcagatttatttgcccaacctgatgttgatggtggactgatt
ggcggtgccagtttaaactctaccgagtttttaagtctgtgtaccatagcgatgagcgca
taa

DBGET integrated database retrieval system