KEGG   Shewanella sp. MR-7: Shewmr7_1103Help
Entry
Shewmr7_1103      CDS       T00389                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00240  Pyrimidine metabolism
shm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Shewmr7_1103
Enzymes [BR:shm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Shewmr7_1103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ABI42102
UniProt: Q0HXQ3
Position
1273688..1275019
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNGLALSTEEIQFFVKGITTNAVSEGQIAALGMAVYFNDMNMDERIALT
TAMRDSGTVLNWQSLGLNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTEPSSELFRKVVKDVGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLACSLDALAMDVKVGSGAFMPTYEASEELARSIAAVANGAGTKTTALLT
DMNQVLASCAGNAVEVKEAIDFLTGAYRNPRLYAVTMGLCAEMLLLGGLATDEADARAKL
NRVLDNGRAAEIFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADTQGYAHSMDTRELG
LAVVTLGGGRRKPGDALDYSVGLTQVCALGDKIDASTPIAVIHAQSEDAFAQAEEAVKKA
IRIDEVAPEKTPEIYAYIRAADL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagctcaagaaattatacgtaagaaacgcaatggtttagccttaagcaccgaa
gagatccagttcttcgtcaagggcataaccactaatgcagtgtcggaaggtcagatcgcc
gcattaggcatggctgtgtactttaatgacatgaatatggatgaaagaatcgctttgact
actgctatgcgcgattctggcactgtactcaattggcaatcacttggtcttaatggccca
gtcatcgataaacacagtactggtggtgtcggtgatgtgattagtctcatgctcggccct
atggctgcagcttgtggtggttatgtgccgatgatttcgggtcgtggactcggacacaca
ggcggtacgctcgataagttcgacgctattcccggttatcaaaccgaaccttcgagtgaa
ttgttccgaaaagtagttaaagacgttggtgtggcgattatcggccaaactggcgatctg
gttcccgccgataaacgtttttactccatccgtgacaacactgcgaccgtcgaatccatc
tccctcatcaccgcctcaattctctctaagaaattagcttgtagtctcgatgcattggcg
atggacgtcaaagtcggtagcggcgcatttatgccaacctacgaagcctctgaagagctt
gcacgcagtattgcggcggtagccaatggcgcaggcactaaaacgacggccttactcacc
gacatgaaccaagtattggcctcatgtgccggtaatgcggttgaagtgaaagaagccatc
gatttcttgactggtgcttaccgtaatccccgtttatacgctgtgactatggggctttgt
gccgagatgttactcctaggcggcctcgccaccgatgaagcggatgcccgtgccaagtta
aatcgagtattagataacggccgcgctgccgagatctttggcaagatggtttcaggcctc
ggtggtccagtcgattttgttgaaaattacagtaagtacttaccgcaatcgcaaattatt
cgccctgtctttgctgatactcaaggttatgctcacagcatggacacccgtgaactcggt
ttagccgtggtcaccttaggaggcggtcgtcgtaaacccggtgatgcactcgactacagt
gttggtctgacgcaagtttgtgcacttggtgataagattgatgcttctacgccgattgcc
gtgatccatgctcaatccgaagatgcctttgctcaagcggaagaagccgtgaaaaaagcg
attcgtatcgacgaagtcgctccagaaaaaacacctgagatctatgcttatatccgagca
gcggatctttaa

DBGET integrated database retrieval system