KEGG   Shewanella sp. MR-7: Shewmr7_1202Help
Entry
Shewmr7_1202      CDS       T00389                                 

Definition
(GenBank) DNA polymerase III chi subunit, HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00230  Purine metabolism
shm00240  Pyrimidine metabolism
shm01100  Metabolic pathways
shm03030  DNA replication
shm03430  Mismatch repair
shm03440  Homologous recombination
Module
shm_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Shewmr7_1202
   00240 Pyrimidine metabolism
    Shewmr7_1202
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Shewmr7_1202
   03430 Mismatch repair
    Shewmr7_1202
   03440 Homologous recombination
    Shewmr7_1202
Enzymes [BR:shm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Shewmr7_1202
DNA replication proteins [BR:shm03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Shewmr7_1202
DNA repair and recombination proteins [BR:shm03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Shewmr7_1202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ABI42201
UniProt: Q0HXF4
Position
complement(1408153..1408617)
Genome map
AA seq 154 aa AA seqDB search
MTQALFYLLPPMGVNTALSDMYQLACRLAQQGFINQQQVYIHCQDKNIAFEIDELLWQFE
PSAFVPHNLKGEGPTTGSPVEIGFDRLGPNKSRQLLINLADQVPPFAVNFGQIFDFVAND
DQHKAIARERYRQYRGLGIELTTQNLATHPLNLA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagcgctgttttatctactgccgccgatgggggtgaacaccgcccttagtgac
atgtatcaattggcttgccgcttggcccaacagggatttataaaccagcaacaggtctat
attcactgtcaggacaagaacattgccttcgaaatcgacgagttattatggcagtttgaa
cccagtgcatttgtcccccacaacctcaaaggtgaaggcccgaccacaggctcacccgtt
gaaatcggttttgacaggctcggcccaaacaaaagtcgccaacttctgattaatcttgca
gaccaagtgcctccgtttgcggtaaactttggtcaaatcttcgattttgtggctaatgac
gaccaacataaagcgatagcacgtgaacgctaccgccaatatcgtggcttagggattgaa
ttaacaacccaaaatttagcaacacatccacttaatttagcttga

DBGET integrated database retrieval system