KEGG   Shewanella sp. MR-7: Shewmr7_1278Help
Entry
Shewmr7_1278      CDS       T00389                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00260  Glycine, serine and threonine metabolism
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01120  Microbial metabolism in diverse environments
shm01130  Biosynthesis of antibiotics
shm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shewmr7_1278
Enzymes [BR:shm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Shewmr7_1278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: ABI42277
UniProt: Q0HX78
Position
1483584..1484597
Genome map
AA seq 337 aa AA seqDB search
MIDLRSDTVTQPTEAMRLAMSRAEVGDDVYGDDPTVNSLQDMAAEMFGFESALFTASGTQ
ANLLALMAHCERGDEYLCGQQAHNYKFEGGGAAVLGSIQPQPLTNQLDGTIVLTDIEAAI
KPDDIHFARTRLLSLENTIGGKVLPQSYLANAQALAFQRGLKIHLDGARVANAAVAQGIG
IADIAGHFDSVSICLSKGLCAPVGSLLLGDERLIKKATRWRKMLGGGMRQAGILAAAGKL
ALIEQVERLGEDHENAAYFAQQLSLLSEFEIDLAAVQTNMVFANLAPHVDEQALAKRCRE
AGILISPSRTLRFVTHKDVSRQDIDKVLQVFKLHLQV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatagatttacgcagtgataccgtgacccagccaacagaggcgatgcgcttagccatg
tcgagggctgaagtaggtgatgatgtttatggtgatgatccgaccgtcaacagcttgcaa
gatatggccgccgagatgtttggctttgagagtgcgctgtttaccgcatctggcactcag
gccaatttgctcgcgctgatggcacattgtgaacgtggagatgaatatctgtgcggccag
caggcccataactataaattcgagggcggtggtgcggcggtactcgggagcattcagccg
caaccgctgaccaatcagctggatggcaccattgtcctgaccgatattgaagcggcgatt
aaacccgatgatattcacttcgcgcgcacgcgcttattgagcctagaaaacactatcggt
ggcaaggtattaccccaatcctatcttgctaatgcgcaggcgctggcatttcagcgtggt
ttaaaaattcacttagatggcgctcgggttgctaatgccgccgtggcccaggggattggg
attgccgatattgcggggcattttgattctgtctccatctgtttatccaaggggttgtgt
gcgcctgttggctcactgctcttaggtgatgagcgcctaattaaaaaggccacgcgctgg
cgtaaaatgctgggcggcggtatgcgccaggcggggatattagcggctgcgggtaaatta
gccctcatcgaacaagttgagcgattaggggaagatcatgagaatgctgcgtattttgct
cagcaattaagtttgttgagtgagtttgaaatcgatttggccgccgttcaaaccaatatg
gtgtttgctaacttagcgccccatgtcgatgagcaagccctagcgaaacgttgccgtgag
gcggggatcctcatcagccctagccgtaccctgcgttttgtgacccataaagatgtctcg
cgtcaggacattgataaagtgctgcaagtgtttaaattacatttgcaggtataa

DBGET integrated database retrieval system