KEGG   Shewanella sp. MR-7: Shewmr7_1758Help
Entry
Shewmr7_1758      CDS       T00389                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00010  Glycolysis / Gluconeogenesis
shm00071  Fatty acid degradation
shm00350  Tyrosine metabolism
shm00620  Pyruvate metabolism
shm00625  Chloroalkane and chloroalkene degradation
shm00626  Naphthalene degradation
shm00650  Butanoate metabolism
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01120  Microbial metabolism in diverse environments
shm01130  Biosynthesis of antibiotics
shm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewmr7_1758
   00620 Pyruvate metabolism
    Shewmr7_1758
   00650 Butanoate metabolism
    Shewmr7_1758
  Lipid metabolism
   00071 Fatty acid degradation
    Shewmr7_1758
  Amino acid metabolism
   00350 Tyrosine metabolism
    Shewmr7_1758
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Shewmr7_1758
   00626 Naphthalene degradation
    Shewmr7_1758
Enzymes [BR:shm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Shewmr7_1758
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Shewmr7_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABI42751
UniProt: Q0HVV4
Position
complement(2074710..2077310)
Genome map
AA seq 866 aa AA seqDB search
MTVTNAQELDLMVERVAKAQAEYASFSQAQVDAIFRAAALAAADARISLAKMAAAETRMG
VIEDKVIKNHFASEYIYNKYKDEKTCGILSEDPTFGTITIAEPVGIICGIVPTTNPTSTA
IFKALISLKTRNAIIFSPHPRAKVSTTTAAKLVLDAAIAAGAPKDIIGWIDEPSAALSNQ
LMTHAKVNLILATGGPGMVKAAYSSGKPAIGVGAGNTPIVIDETADIKRAVSSILMSKTF
DNGVVCASEQAVIVVDSIYEQVKERFATHGGYLLNAAQTAAMQQVILKNGGLNADIVGQS
AATIAQMAGIDVPHTTKVLIGEVTDITEAEAFAHEKLSPLLGMYRAADFNDAVDKAEALV
ALGGIGHTSGLYTDQDTQTERVKIFGFRMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPSHLINKKTVAKRAENMLWHKLPSSIYFRRGSLPIALEELSDKKRA
LVVTDRFLFNQGYCDETLKILKAQGLETEVFYEVEADPTLATVRQGAKVANNFKPDVIIA
LGGGSPMDAAKIIWVMYEHPDVDFADLALRFMDIRKRIYKFPKMGVKATMVAIPTTSGTG
SEVTPFAVVTDEQTGKKYPIADYQLTPNMAIVDPNLVMDMPKSLTAFGGIDAITHALEAY
VSVMANEYSDGQALQALDLLCKYLPDAYELGAASPIAREKVHNGATIAGIAFANAFLGIC
HSMAHKLGAEFHLAHGLANALLISNVIRFNATDLPTKQAAFSQYDRPKALCRYAAIADHL
ALGGSSDAEKVEKLLEKIEQLKKTLGIPASIQEAGVNEADFLAKLDELAEDAFDDQCTGA
NPRYPLISELKQLLLDSYYGRPFTEQ
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaactaatgctcaagaactggatctcatggtcgagcgcgtcgccaaagcgcaa
gccgaatatgccagttttagccaagcacaagtcgatgcgattttccgcgccgccgcactg
gccgccgccgatgcgcgcatatcgcttgcgaaaatggccgccgccgaaacccgaatggga
gtgattgaagacaaagtgattaaaaaccactttgcctccgagtacatttacaacaaatac
aaagatgaaaagacctgcggaattttatccgaggaccccaccttcggtactatcactatc
gccgagcccgtgggtattatctgtgggattgtccccaccacgaatcccacttccaccgcc
attttcaaagcattgatcagccttaaaacccgcaatgcgattattttctcgcctcaccca
agggcgaaagtctcgaccaccacagcggctaaactggtgctagatgctgccattgccgcc
ggtgcgcccaaggacattatcggctggattgatgagcccagtgcggcactttccaatcaa
ttgatgacacatgctaaagtgaaccttatcctcgccacaggcggcccaggtatggtgaaa
gctgcctactcctctggcaaacccgcaattggcgtgggcgcgggtaacacaccaattgtt
atcgatgaaaccgccgacataaaacgcgcggtcagctcgattttgatgtctaaaaccttc
gataacggcgttgtctgtgcctcagagcaagcggtaattgtggttgacagtatctacgag
caagtcaaagagcgcttcgcgacccatggcggttacctcttaaatgcagcgcaaaccgct
gcgatgcaacaagtcatccttaaaaatggcggcttaaatgccgatatcgtcggccaaagc
gccgcaaccatagcgcaaatggcgggcattgatgtcccccacactaccaaggtcttgatt
ggtgaagtcacggatatcactgaggccgaagcctttgcccacgaaaaactctcaccatta
cttggcatgtaccgcgccgccgatttcaatgacgccgtcgataaggctgaagccttggtc
gccttaggcggtatcggccatacatcaggcttatataccgaccaagacacccaaaccgag
cgagtgaaaatctttggttttagaatgaaaactgcgcgaattctaatcaacaccccagct
tcacaaggcggaattggcgatctgtacaactttaaactcgctccttcgctcaccttaggt
tgtggctcttggggcggaaactcgatttctgaaaacgtcggcccaagccatttaattaat
aagaaaaccgtcgctaagagggctgaaaacatgctgtggcacaagcttccttcgtctatc
tactttcgccgcggcagtttacctattgcgcttgaagaattgagcgataaaaaacgtgcc
ctcgtagtaaccgacagattcctgtttaaccaaggttattgcgacgaaaccttaaagatt
ttaaaagcccaaggtcttgaaaccgaagtcttttacgaggtggaagccgatcccacactg
gccacagtgcgccaaggtgccaaagtcgccaataattttaaacccgatgtgattattgcc
ttaggcggtggctcgcccatggatgcggccaagattatttgggtgatgtacgagcatccc
gatgtcgactttgccgatttagccctgcgttttatggatatccgtaaacgtatctataaa
ttccctaaaatgggcgtcaaagccactatggtggcaatccccaccacatccggcacaggc
tcagaggtcacaccgtttgccgtagtaaccgatgagcaaaccggtaaaaaataccccatc
gccgactatcaactcactcctaacatggcaattgttgacccgaatcttgtgatggatatg
ccgaaatccttaaccgctttcggcggaatcgatgcgattacccacgcgctcgaagcctat
gtcagcgtgatggccaatgagtacagcgatggtcaagccctgcaggcacttgacctactg
tgcaaatatttacccgatgcctacgagcttggcgccgcatcccctatcgcccgagaaaaa
gtgcataatggtgcgaccatagccggtatcgcctttgccaacgccttccttgggatctgt
cactctatggcccataaactgggcgccgagtttcatttagcccatggacttgccaatgcg
ctactcatcagtaacgtgatccgctttaatgcgaccgacttacccactaagcaagccgca
ttcagccaatacgacagaccaaaagccctgtgtcgttacgcggcgattgccgatcattta
gccttaggtggaagttctgatgcggaaaaagtcgagaaattgctggaaaaaatcgagcaa
ctcaagaagacgctgggcattcctgcatctatccaagaagcgggagttaacgaagccgac
ttcctcgccaaactagacgagctcgccgaggatgccttcgatgaccaatgcactggcgcg
aaccctcgctatcctttgatcagtgagttaaaacagctactgctcgacagctactatggc
cgcccatttactgagcaatag

DBGET integrated database retrieval system