KEGG   Shewanella sp. MR-7: Shewmr7_2664Help
Entry
Shewmr7_2664      CDS       T00389                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00071  Fatty acid degradation
shm00072  Synthesis and degradation of ketone bodies
shm00280  Valine, leucine and isoleucine degradation
shm00310  Lysine degradation
shm00362  Benzoate degradation
shm00380  Tryptophan metabolism
shm00620  Pyruvate metabolism
shm00630  Glyoxylate and dicarboxylate metabolism
shm00640  Propanoate metabolism
shm00650  Butanoate metabolism
shm00900  Terpenoid backbone biosynthesis
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01120  Microbial metabolism in diverse environments
shm01130  Biosynthesis of antibiotics
shm01200  Carbon metabolism
shm01212  Fatty acid metabolism
shm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:shm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shewmr7_2664
   00630 Glyoxylate and dicarboxylate metabolism
    Shewmr7_2664
   00640 Propanoate metabolism
    Shewmr7_2664
   00650 Butanoate metabolism
    Shewmr7_2664
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Shewmr7_2664
   00072 Synthesis and degradation of ketone bodies
    Shewmr7_2664
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shewmr7_2664
   00310 Lysine degradation
    Shewmr7_2664
   00380 Tryptophan metabolism
    Shewmr7_2664
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Shewmr7_2664
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Shewmr7_2664
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Shewmr7_2664
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shm04147]
    Shewmr7_2664
Enzymes [BR:shm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Shewmr7_2664
Exosome [BR:shm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shewmr7_2664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt PDT
Motif
Other DBs
NCBI-ProteinID: ABI43649
UniProt: Q0HTA6
Position
complement(3150396..3151586)
Genome map
AA seq 396 aa AA seqDB search
MSTEQFNQEIVIVAAKRTPMGGFQGSLSGVTSPSLAATAIKALLADTQVAPDKVDEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTMMLAHDLLKAGSAKLVVAGG
MESMSQAPYLLDKARSGMRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADEYGLTREQ
MDAFALSSLEKANAAINSGAFKAEIVPVTVSDRRGDVTIDTDEQPGNARPEKIPTLRPAF
AKDGTITAANSSSISDGAAALMLTTRANAEQLGLTVLATIKGHTTHAQEPSLFTTAPVGA
MAKLLSNVGWSKDEVDLFEINEAFAMVTMLAVSELGLDMAKVNVNGGACALGHPIGCSGA
RLLVTLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaacaatttaaccaagagatcgttattgttgccgctaaacgcaccccaatg
ggtggctttcaaggcagtttgtctggcgtaacgtctccgagcttagcggccaccgccatc
aaagccctgttagctgacacccaagtagcgcctgacaaggtcgatgaagtgttaatgggc
tgcgtattgccagcgggtctgggtcaagcgcctgcgcgtcaggcgaccttaggtgcaggt
ttacctctgtctgtaggcgcaaccacagtgaacaaagtctgtggctctgggatgaaaacc
atgatgctcgcccatgatttattgaaggcgggaagtgctaagttggtggttgctggtggt
atggaaagcatgagccaagccccttacttgctagataaagcgcgctcaggcatgcgtatg
ggtcatggcaaggtattagatcatatgttcctcgacggtttagaagatgcctacactggc
ggcgccatgggcacattcgcccagaaaaccgccgatgaatacggcctaacccgcgagcaa
atggacgccttcgccctgagctcattggaaaaagccaatgcggccattaactctggtgcc
ttcaaggcggagattgtgcctgtcacggtaagcgatcgccgtggtgatgtgactatcgat
accgatgagcagccaggtaatgcccgtcctgaaaaaatcccaaccctgcgtccagctttt
gctaaagacggcactattactgcggcaaactcaagctcaatttcagatggtgcggcggcg
ctaatgttaaccacccgcgcgaatgccgagcagttaggcttaactgtgctcgccactatc
aagggccacactacccatgcccaggagccatcactctttaccacggcgcccgttggcgct
atggcaaaactgctgagcaatgtgggctggtcaaaggatgaagttgatctgttcgaaatc
aacgaagcctttgccatggtgactatgctagccgtttctgaattaggtttagacatggca
aaagtgaacgtgaacggtggcgcctgcgccttaggtcatcctatcggttgctcgggcgca
cgtttactggtgaccttaatccatgcacttaaagcccgtgggcttaagcgtggcgtagcc
tcactttgtatcggtggtggtgaagcgactgctatggctatcgaagtttaa

DBGET integrated database retrieval system