KEGG   Shewanella sp. MR-7: Shewmr7_2674Help
Entry
Shewmr7_2674      CDS       T00389                                 

Definition
(GenBank) Phenylalanine 4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00360  Phenylalanine metabolism
shm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
shm00790  Folate biosynthesis
shm01100  Metabolic pathways
shm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Shewmr7_2674
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Shewmr7_2674
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Shewmr7_2674
Enzymes [BR:shm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Shewmr7_2674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ABI43659
UniProt: Q0HT96
Position
complement(3160726..3161541)
Genome map
AA seq 271 aa AA seqDB search
MTKEIAHTAPYVARSADDSGFIHYPQEEHDIWSQLYARQAVNLPGRACKEYLQGLDALAM
PKDRIPQLAEIDKVLQATTGWKTAAVPALISFGRFFELLANKEFPVATFIRRKEEFDYLQ
EPDIFHEIFGHCPLLTNPSFAHFSHIYGQLGLNASKEDRVFLARLYWFTVEFGLLKPQDG
ELCIYGGGILSSPGETLYAMESQVPERKPFDLLDVLRTPYRIDIMQPIYYVIEHIDMLDE
IAKMDIMAYVAKARQLGLFAPKYPPKTKKAS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagagatagcgcacactgcgccctatgttgcgcgaagtgcagatgattcaggg
tttatccattacccgcaggaagaacatgatatttggagccaattgtatgctcgccaagcg
gtgaacctaccggggcgtgcctgtaaggaatatcttcaaggactcgatgccttggctatg
cctaaggatcgcattccacaattggctgagattgacaaagtattgcaggccacgactgga
tggaaaaccgcggccgtgccggctttgatttcctttggccgcttctttgagctattggcc
aacaaggaatttccggttgcgacctttatccgccgcaaggaagagtttgattatctgcaa
gagccggatattttccatgagatctttggccattgccccttgctgactaatccttctttc
gcccatttctcccatatctatggtcaattgggtttaaatgccagcaaagaagaccgcgtc
tttttagcgcgcctgtattggtttaccgtcgagtttggcctactcaaacctcaagatggc
gaattgtgtatctacggcggcggtattttaagctctcccggcgaaaccttgtatgcgatg
gaaagccaagtgccggagcgtaagcccttcgacctcttagatgtgctgcgcacgccttac
cgtatcgatattatgcagccgatttattatgtgattgaacatattgatatgctggatgaa
atagccaagatggacatcatggcctatgtggctaaggcgcgtcagttaggcttatttgct
cctaagtatccgcccaagaccaagaaagccagctaa

DBGET integrated database retrieval system