KEGG   Shewanella sp. MR-7: Shewmr7_2675Help
Entry
Shewmr7_2675      CDS       T00389                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00040  Pentose and glucuronate interconversions
shm00052  Galactose metabolism
shm00500  Starch and sucrose metabolism
shm00520  Amino sugar and nucleotide sugar metabolism
shm01100  Metabolic pathways
shm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Shewmr7_2675
   00052 Galactose metabolism
    Shewmr7_2675
   00500 Starch and sucrose metabolism
    Shewmr7_2675
   00520 Amino sugar and nucleotide sugar metabolism
    Shewmr7_2675
Enzymes [BR:shm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Shewmr7_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABI43660
UniProt: Q0HT95
Position
3161865..3162773
Genome map
AA seq 302 aa AA seqDB search
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIDAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDDASCDLKTDNLAAMVNLFDETQVGQIMVEGVPHHLVNQYGI
ADVNGHDLQPGESEPLVELVEKPPVDEAPSNLAVVGRYVLPAAIWPLLAKTPAGAGDEIQ
LTDAIAMLMKQETVNAYYMQGKSHDCGNKQGYMRANVEYALRHSEIGEDFAHYLKTVVKG
IK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacatcaaattcgtaaagccgttattcctgtcgctggacttggcactcgtatg
cttcctgcgaccaaagctatcccaaaagaaatgttacccgttgttgataagccattgatc
caatacgtggttagcgaagccattgatgcgggtattaaagaaattgtcctcgtaacccac
gccagtaaaaactctatcgaaaaccatttcgacaccagttttgaattagaagcgcaatta
gagcgccgcgtgaagcgtcaattactcgaagcggttcaatccatttgcccgaaagacgtc
acagtgatcagtgtgcgtcaatcccaagcgaaaggtttaggccacgcgattttatgtgct
aaatccgtggtaggtgatgcgccgtttgccgtattgctgccggatgtgattatcgatgat
gccagctgcgacctcaaaaccgacaaccttgccgctatggtcaatctgtttgatgaaacc
caagtgggtcaaatcatggttgaaggcgtgccacatcatctagtgaaccaatacggtatt
gcggatgtgaatggccacgatctgcaacctggtgagtctgagccattggtcgaactcgtt
gaaaagccaccggttgatgaagcgccatctaacttagctgtagtgggtcgttacgtgcta
cctgcggcaatttggccactactagccaaaactcctgctggcgcgggtgatgaaatccaa
ttaactgacgcgattgcgatgttaatgaagcaagaaaccgtaaacgcttactacatgcaa
ggtaagagtcacgactgcggtaacaagcaaggttatatgcgtgctaacgtagaatacgcc
ctgcgccacagcgaaatcggtgaagattttgcccactatttaaagacagttgtaaaagga
attaaataa

DBGET integrated database retrieval system