KEGG   Shewanella sp. MR-7: Shewmr7_2684Help
Entry
Shewmr7_2684      CDS       T00389                                 

Definition
(GenBank) 3'(2'),5'-bisphosphate nucleotidase
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00920  Sulfur metabolism
shm01100  Metabolic pathways
shm01120  Microbial metabolism in diverse environments
shm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Shewmr7_2684
Enzymes [BR:shm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Shewmr7_2684
Transfer RNA biogenesis [BR:shm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Shewmr7_2684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P FBPase ThuA
Motif
Other DBs
NCBI-ProteinID: ABI43669
UniProt: Q0HT86
Position
complement(3171524..3172330)
Genome map
AA seq 268 aa AA seqDB search
MTDNTAMAEHFSKADLLRVVKIAHAAGDAIMAIYAQEDFAVTQKRDESPVTAADLAAHKV
ILAQLTEQFAGIPVMSEEAADIAWDERRHWQTYWLIDPLDGTKEFIKRNGEFTVNIALIH
QGVAIAGVVYAPVLNTVYFGAKHLGAWRQDGQQELVLQGCNPPRHVPIVVGSRSHLSPDV
AEYLKDFGQHEMLSVGSSLKFCMLAEGKADLYPRLGPTSEWDTAAAQAVLESAGGKVVCY
DSGLPLTYNQKPDILNPYFIATAPGWAE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgacagataatacagcgatggcagagcatttttcgaaggccgatttactgcgggtggta
aagattgcccatgcggcaggcgacgccatcatggcgatttatgcccaagaggattttgcc
gttacgcaaaagcgtgatgagagcccagtgacggcggccgatttggcggctcacaaagtt
atcttggcccagcttaccgagcaatttgcaggcattcccgtgatgtcggaagaagcagct
gatattgcctgggatgaacgtcgacactggcagacctattggctgatagaccctttagat
ggcactaaggaatttattaagcgaaatggtgagtttaccgtcaatattgcgcttatccat
caaggtgttgctattgcgggtgtggtttatgcgcccgtgctcaatactgtctattttggc
gccaaacacttaggcgcttggcgacaggatgggcaacaagaactggtgctacagggctgt
aacccgccaagacatgtaccgattgtggtgggtagtcgttcgcatctaagccctgatgtg
gcggaatatttaaaggatttcggtcaacacgagatgttaagcgtgggaagctcgctgaag
ttttgtatgttggcagagggcaaggccgatctctatccaagattagggcctacgagcgaa
tgggacacggcagccgcgcaggccgtgctggaaagcgcaggcggcaaagttgtgtgttat
gactcaggtttacccttaacctacaatcaaaaacctgacatattaaacccttattttatt
gccacggcgccaggctgggcagaataa

DBGET integrated database retrieval system