KEGG   Shewanella sp. MR-7: Shewmr7_2990Help
Entry
Shewmr7_2990      CDS       T00389                                 

Definition
(GenBank) RNA polymerase, sigma 70 subunit, RpoD
  KO
K03086  RNA polymerase primary sigma factor
Organism
shm  Shewanella sp. MR-7
Brite
KEGG Orthology (KO) [BR:shm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:shm03021]
    Shewmr7_2990
Transcription machinery [BR:shm03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Shewmr7_2990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_ner Sigma70_r1_1 Sigma70_r3 Sigma70_r2 Sigma70_r4 Sigma70_r1_2 TMPIT
Motif
Other DBs
NCBI-ProteinID: ABI43974
UniProt: Q0HSD1
Position
3540311..3542170
Genome map
AA seq 619 aa AA seqDB search
MISMDHTPQSQLKLLLAKGKEQGYLTYAEVNDHLPADMVDSDQIEDIIQMINDMGIRVFE
EAPDADDMMMSEDNTDEDAAEEAAAALATVESELGRTTDPVRMYMREMGTVELLTREGEI
VIAKRIEEGINTVQSSVAEYPQAIAMILEQYDQYEADELRLSDIISGFVNPDEEDLGPTA
THIGSELSEEDLDDEDDDEEDEDEDGDGDGDDDGNKGPDPEEARERFGQLRTAYENALKI
IEAKGREHPESIKALFEIGEIFKEFRLVPKQFDRLVKSMRSMMDRVRVQERLLMKLCVEQ
AKMPKKNFVKFFTGNETNLDWFDAEKNSTKPYAEGLRMVEEDVQRCRSKLAAIEEETGLV
IAAIKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMK
AVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEM
GREPSPEELAERMMMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDS
ATSESLKSATHEVLAGLTAREAKVLRMRFGIDMNTDHTLEEVGKQFDVTRERIRQIEAKA
LRKLRHPSRSEILKSFLDE
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgatatctatggatcatactccgcagtcgcaactcaagctgttgcttgccaaaggtaaa
gagcaaggttacttaacctatgcagaagtgaacgatcacttacctgcagacatggtcgat
tctgaccagatcgaagatattatccagatgataaatgacatgggtattcgggtgttcgaa
gaagcaccagatgccgatgacatgatgatgtcggaagacaacacagacgaagatgcagca
gaagaagccgcagccgcccttgccacagtagaaagtgagctaggccgtaccacagaccct
gtgcgtatgtacatgcgcgaaatgggtaccgttgaactgctgacccgtgaaggcgaaatt
gttatcgccaaacgcatcgaagaaggcatcaacacagttcaaagctctgtcgcagaatac
ccacaagcgatcgccatgatccttgagcagtacgaccagtacgaagccgacgaactgcgc
ctgtctgatattatctctggatttgttaacccggacgaagaagacctaggcccaaccgca
acccatatcggctctgaattatcggaagaagatctcgatgatgaagatgacgatgaagaa
gatgaagacgaagacggtgatggcgacggcgatgacgatggcaacaagggtcccgaccct
gaagaggcgcgtgaacgctttggccaattaagaacggcctacgaaaatgcccttaaaatc
atcgaagccaaaggtcgtgaacatcctgaatcgatcaaagcactgtttgaaatcggtgag
attttcaaagagttccgcctagtacccaagcagttcgaccgcttagtaaaaagcatgcgt
tctatgatggaccgtgttcgtgtacaagagcgtctgctgatgaagctttgtgtcgaacag
gccaaaatgccgaagaagaacttcgttaaattcttcaccggaaacgaaaccaatttagat
tggttcgatgcagaaaagaactcaaccaagccttatgccgaaggcttaagaatggttgaa
gaagacgtacagcgttgccgtagcaagctggccgccatcgaagaagaaactggcttagtg
attgctgccattaaagacatcaaccgtcgtatgtcaatcggtgaagccaaggctcgccgt
gcgaagaaagagatggttgaggcaaacttacgtctggtaatttctatcgcgaagaaatac
accaaccgtggtctgcaattcttggacttaatccaagaaggtaacatcggtttgatgaag
gcagttgataagttcgaataccgtcgtggttacaagttttcgacctatgcgacttggtgg
atccgtcaggcaatcacccgctcaatcgcggaccaagcccgtacaatccgtattccagta
cacatgatcgaaaccatcaacaagctgaaccgtatctctcgccaaatgctacaggaaatg
ggtcgtgagccttctcctgaagaactggcagagcgtatgatgatgccggaagataagatc
cgtaaggtactgaaaatcgctaaagaacctatctccatggaaaccccaataggtgacgat
gaagattcgcatttaggtgattttatcgaggatactaccctcgaattaccactggacagc
gccactagcgaaagcctgaagagcgcgacccatgaggtattagctggcctaacagcccgt
gaagcgaaagtactgcgtatgcgttttggtatcgacatgaataccgaccacacgctggaa
gaagtgggtaaacaatttgacgtgacccgtgaacgtatccgtcaaattgaggcgaaagcc
ctgcgtaaactacgccacccttcacgctcggaaatcttaaagtcattcttagacgaatag

DBGET integrated database retrieval system