KEGG   Shewanella sp. MR-7: Shewmr7_2992Help
Entry
Shewmr7_2992      CDS       T00389                                 

Definition
(GenBank) amino acid/peptide transporter
  KO
K03305  proton-dependent oligopeptide transporter, POT family
Organism
shm  Shewanella sp. MR-7
Brite
KEGG Orthology (KO) [BR:shm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Shewmr7_2992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTR2 MFS_1
Motif
Other DBs
NCBI-ProteinID: ABI43976
UniProt: Q0HSC9
Position
3545291..3546841
Genome map
AA seq 516 aa AA seqDB search
MTLGTNQVSKTHSFMTVSLIELWERFGYYGMQALIVYFMVQRLGFDDSRANLVWSACAAL
IYVSPAIGGWVGDKILGTKRTMLLGAGILSVGYALMTVPTENTWFMFSALGVIVVGNGLF
KPNAGNLVRKIYEGDDSKIDSAFTIYYMAVNVGSTFSMLLTPWIKDYVNAQYGNEFGWHA
AFAVCCVGLIVGLGNYALMYKSLANYGSEPDTRPVNKKNLAIVLVLAALSVVASAIILEY
EDVARVFVYAAGVAVLGIFFHLIRTSEPSERAGLIAALILTVQTVFFFIFYQQMSTSLAL
FALRNVDWDFQVFGTHLWTWSPAQFQALNPIWIMVLSPVLAWSYSWAGRNNKDFSIAAKF
ALGFAVVAIGFFIYGFAGQFAVEGKTSSWVMIWGYASYSLGELLVSGLGLAMIARYVPAR
MGGFMMGAYFVASGISQYLGGVVANFASVPQDLVDPLQTLPVYTNLFNKLGIAAVVCTFI
ALAVLPLMRRLTESHHAHNSIEDNAAASLRDVKAEQ
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgactcttggtaccaatcaggtaagcaagacacattcatttatgactgtgtcacttatc
gaattatgggaacgttttggttattacggcatgcaggcgctgatcgtgtactttatggta
cagcgtcttggctttgatgactcccgtgcaaacttagtttggagtgcctgtgcggcgctg
atttacgtgtcgccagccattggtggttgggttggggataaaattctcggcaccaaacgc
accatgctgctcggtgcaggcattttatctgtcggctatgccctaatgacagtgccaact
gaaaacacttggtttatgttctccgcacttggggtaattgtggtcggtaacggcctgttt
aagcccaatgccggtaacttagtccgtaagatctacgaaggcgacgattctaaaatcgac
agcgcctttaccatctattacatggcggtaaacgtaggttcgaccttctctatgctgcta
acgccttggattaaggactatgtaaatgcccaatacggtaacgagtttggctggcacgcc
gcctttgccgtgtgttgtgtgggcttaatcgtcggcttaggtaactatgcactgatgtac
aagagcctcgccaactatggttcagagccagatactcgcccagttaataagaagaacttg
gcgatcgtgttggtattagcggcgctttcggttgttgcttcagccattattcttgaatat
gaagatgttgcccgtgtattcgtatatgcggctggtgtcgcggtattagggattttcttc
catttaattcgtaccagtgagccaagtgagcgtgccggccttatcgcggcgcttatcctc
acagtgcagaccgtcttcttctttatcttctatcaacaaatgtcgacctcactggccctg
tttgcgctgcgtaacgtcgattgggatttccaagtctttggtacccatttatggacttgg
tctcctgcacagttccaagcactgaatccaatctggatcatggtgttaagcccagttttg
gcctggagttattcttgggcgggccgcaataataaggacttttcgattgccgctaagttc
gccttaggttttgcggttgtcgccattggcttctttatctacggttttgcaggccaattt
gccgttgagggtaaaacctcttcttgggtgatgatttggggttatgcctcatactcgctg
ggcgaactgctggtgagcggtcttggtttagccatgatcgcccgctacgtgcctgcacgc
atgggcggctttatgatgggcgcgtatttcgtggcatcggggatttcccagtacttaggc
ggcgttgtagccaactttgctagcgtgccacaggacttagtcgatccgctgcaaactctg
cccgtttataccaatttattcaataaattaggtattgcggccgtggtctgtacttttatc
gccttagctgtattgccgctgatgcgccgtttgacagaaagccatcatgcccataacagt
attgaagataatgctgcggcctcactgcgtgatgtaaaagccgagcaataa

DBGET integrated database retrieval system