KEGG   Shewanella sp. MR-7: Shewmr7_2994Help
Entry
Shewmr7_2994      CDS       T00389                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00250  Alanine, aspartate and glutamate metabolism
shm00280  Valine, leucine and isoleucine degradation
shm00410  beta-Alanine metabolism
shm00640  Propanoate metabolism
shm00650  Butanoate metabolism
shm01100  Metabolic pathways
shm01120  Microbial metabolism in diverse environments
Module
shm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:shm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Shewmr7_2994
   00650 Butanoate metabolism
    Shewmr7_2994
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Shewmr7_2994
   00280 Valine, leucine and isoleucine degradation
    Shewmr7_2994
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Shewmr7_2994
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:shm01007]
    Shewmr7_2994
Enzymes [BR:shm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Shewmr7_2994
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Shewmr7_2994
Amino acid related enzymes [BR:shm01007]
 Aminotransferase (transaminase)
  Class III
   Shewmr7_2994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABI43978
UniProt: Q0HSC7
Position
complement(3548314..3549591)
Genome map
AA seq 425 aa AA seqDB search
MSTTNDSLMARRQAAVAGGVGQIHPVFTARAENATVWDVEGREFIDFAGGIAVLNTGHLH
PKVKAAVAAQLEDFSHTCFMVLGYESYIQVCEKLNQLVPGDFAKKTALFTSGSEAVENAV
KVARAYTKRAGVIAFTSGYHGRTMAALALTGKVAPYSKGMGLMSANVFRAEFPCALHGVS
DDDAMASIERIFKNDAEPSDIAAIILEPVQGEGGFYAASPAFMQRLRALCDREGIMLIAD
EVQTGAGRTGTFFAMEQMGVSADITTFAKSIAGGFPLSGITGKAEVMDAIGPGGLGGTYG
GNPLACAAALAVLEVFEEEKLLERANAIGERIKSALNTMQVEHPQIADVRGLGAMIAIEL
MEDGKPAPQYCAQILAEARNRGLILLSCGTYGNVLRILVPLTVPDEQLGAGLGILKACFD
AVLKG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaccaatgattcattgatggcacgtcgccaagccgcagtcgcaggcggtgtt
ggtcaaattcatcctgtttttactgctcgcgccgaaaacgcgaccgtgtgggatgttgaa
ggtcgagagtttatcgattttgcgggtggtattgcggtgcttaacactgggcatttacat
cctaaggtgaaggcggctgttgcggcgcagcttgaggacttctcccacacctgttttatg
gtgcttggctatgaaagttatattcaagtctgtgagaaactgaatcagttagtgccgggg
gattttgccaagaagacggccttattcaccagcggctcagaagcggttgaaaacgcggtt
aaagtggctcgtgcatacactaagcgggcgggtgtgattgcctttacctcgggttaccat
ggtcgcactatggcggcgctggcattaacgggaaaggtcgcgccttacagtaaaggtatg
ggattaatgtcggctaatgtgttccgcgccgagttcccctgtgcgctgcacggcgtgtca
gatgatgatgcgatggcctctatcgaacgtatctttaaaaacgatgccgagccgagcgat
atcgcggccatcatccttgagccagtgcagggtgagggtggattctatgctgcatcgcca
gcctttatgcagcgtttacgcgcgctttgcgaccgtgaaggcataatgttgattgccgat
gaagtgcaaacgggggcgggtcgcaccgggaccttcttcgccatggagcaaatgggtgta
agcgccgatatcaccacctttgctaaatccattgctggtggtttccccctttcaggtatt
acgggtaaagctgaagtcatggatgccatcggtcccggcggccttggcggcacctacggc
ggtaatccgctggcctgtgcggcggcgctcgccgtacttgaggtgtttgaagaggaaaag
ctgcttgaacgtgccaatgcaattggcgagcggattaagtcggcgctaaacactatgcag
gttgaacatcctcaaatcgccgatgtgcgtggtctaggggcgatgatcgccattgaattg
atggaggatggtaaacctgcgcctcagtactgtgcccaaatcttagccgaggccagaaac
cgaggattgatcctcctttcctgtggcacctacggcaacgtgctgcgtattttggtgcca
ttgacagtgccagacgagcagctcggtgcggggctgggcattcttaaagcctgcttcgat
gctgtgttaaaaggttaa

DBGET integrated database retrieval system