KEGG   Shewanella sp. MR-7: Shewmr7_2995Help
Entry
Shewmr7_2995      CDS       T00389                                 

Definition
(GenBank) succinate semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00250  Alanine, aspartate and glutamate metabolism
shm00310  Lysine degradation
shm00350  Tyrosine metabolism
shm00650  Butanoate metabolism
shm00760  Nicotinate and nicotinamide metabolism
shm01100  Metabolic pathways
shm01120  Microbial metabolism in diverse environments
Module
shm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:shm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Shewmr7_2995
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Shewmr7_2995
   00310 Lysine degradation
    Shewmr7_2995
   00350 Tyrosine metabolism
    Shewmr7_2995
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Shewmr7_2995
Enzymes [BR:shm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     Shewmr7_2995
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     Shewmr7_2995
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     Shewmr7_2995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABI43979
UniProt: Q0HSC6
Position
complement(3549694..3551142)
Genome map
AA seq 482 aa AA seqDB search
MLLKDPSLLRQQCYINGQWCDAQSKETVAIANPATGAVIASVPVMGQAETQAAIAAAEAA
LPAWRALTAKERGAKLRRWFELLNENSDDLALMMTTEQGKPLAEAKGEVTYAASFIEWFA
EEAKRVYGDTIPGHQGDKRIMVIKQPVGVTAAITPWNFPAAMITRKAAPALAAGCTMVVK
PAPQTPFTALALAVLAERAGIPAGVFSVITGDAIGIGNEMCSNPVVRKLSFTGSTQVGIK
LMEQCAPTLKKLSLELGGNAPFIVFDDANIDAAVEGAMIAKYRNAGQTCVCANRIYVQAG
VYDEFARKLSIAVGKLKVGEGITEGVTTGPLINRAAVEKVQSHLEDALSKGATVVAGGKP
HSLGGNFFEPTVLTHVDSSMRVAREETFGPLAPLFKFTDVDDVIKQANYTEFGLAAYFYG
RDISLVWKVAEALEYGMVGINTGLISTEVAPFGGMKSSGLGREGSKFGIEEYLEIKYICM
SV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtgttgttaaaagaccctagtctgctacgtcagcaatgttatatcaatggtcagtggtgc
gatgcacagtcaaaagaaactgtcgctatcgccaatcccgcgacgggcgcggtgatcgcc
agtgtccctgtgatggggcaagccgaaactcaagcggcgatagcggcagccgaagcagcc
ttgcccgcatggcgagcgcttaccgcaaaagagcgtggtgctaagctgcgtcgctggttt
gaattactcaatgaaaacagtgatgacttagcgttgatgatgaccactgagcagggcaaa
cccctcgccgaagctaagggtgaagtcacctacgccgcctcctttatcgaatggttcgcc
gaagaggcaaagcgcgtctatggcgatacgattcctgggcatcagggcgataaacgcatc
atggtgatcaagcagcccgtgggcgtgactgcggctattactccttggaacttccctgcg
gcgatgatcacccgcaaagccgcgccagcactggctgccggttgtactatggtggtgaaa
cctgcgccgcaaacgccttttaccgcattagccttagccgtgcttgccgagcgcgccggg
atccccgctggggtgtttagcgtgatcactggtgatgctatcggcattggtaatgagatg
tgcagcaaccccgtcgtgcgtaagttgtcttttactggctcgacccaagtgggcattaag
ttgatggagcaatgcgcgccgactctgaagaaattatctttagaattaggcggtaacgcg
ccatttatcgtattcgacgatgccaatatcgatgcggcggttgaaggcgccatgatcgct
aagtatcgcaatgcggggcaaacctgtgtctgcgctaaccgtatttatgttcaggcgggc
gtgtatgacgaatttgcccgcaagctcagtattgcggtgggcaaattaaaggtaggtgag
gggattactgaaggcgtcactacgggaccactcatcaatcgcgcggcggtcgaaaaagtc
cagagccatcttgaggatgcgctcagtaaaggggcgactgtggttgcgggcggcaagccc
catagcttgggcggcaacttcttcgagccaactgtactgacacatgtcgatagcagtatg
cgtgtcgcccgtgaagaaacctttggcccattggcgccgctgtttaagtttaccgatgtg
gacgatgtgattaagcaagccaattataccgagtttggcttggcggcttatttttatggc
cgtgatatctcactcgtgtggaaagtggccgaggcattggaatacggcatggtgggcatc
aacactgggttgatttccactgaagtcgcgccgtttggcggaatgaaatcctcaggactt
ggccgagaaggctctaagttcggcatcgaagaatatttagaaatcaaatatatctgtatg
tctgtttaa

DBGET integrated database retrieval system