KEGG   Shewanella sp. MR-7: Shewmr7_2998Help
Entry
Shewmr7_2998      CDS       T00389                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K11075  putrescine transport system permease protein
Organism
shm  Shewanella sp. MR-7
Pathway
shm02010  ABC transporters
Module
shm_M00300  Putrescine transport system
Brite
KEGG Orthology (KO) [BR:shm00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Shewmr7_2998
Transporters [BR:shm02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putrescine transporter [MD:M00300] [OT]
    Shewmr7_2998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABI43982
UniProt: Q0HSC3
Position
complement(3553578..3554483)
Genome map
AA seq 301 aa AA seqDB search
MKMKSKLKWLKGRFWTISFPYAWLLLFFALPFAIVLKISFSTAAISIPPYEATFQYADDV
LNIFLHLGNYLMLLDDSLYYTAYLSSLKMALISTIGCLIIGYPMAYAIARAPARLQTVLL
LLVMLPSWTSFLIRVYAWMGILSNTGIINNTLMWLGVISEPLQILNTNIAVYIGIIYAYL
PFMILPLYATLVKLDMSLIEAASDLGSSRLNTFWKITFPLSKSGVIAGSMLVFIPAVGEF
VIPELLGGPDSLMIGKVLWQEFFNNRDWPVASSLAIVMLALLIIPITLFHRYQARSLEKD
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaagtcaaaactaaaatggcttaagggacgtttctggacgattagcttcccc
tacgcttggctgttgttgttcttcgccttgccctttgccattgttcttaagatcagtttt
tcgacggcggcgatttcgattccgccctacgaggcgaccttccaatatgcggatgatgta
ttaaacatcttcctgcatttaggcaactacttgatgttgctagatgattcgctgtattac
accgcgtatctcagttcattaaaaatggcgctgatttcgaccattggctgtttgatcatt
ggttatcccatggcctatgccattgcccgtgcgccagcaaggttgcaaaccgtgttgttg
ttattggtgatgttaccttcttggacctcgttcttgatccgcgtttatgcctggatgggg
atcttaagtaacacggggattatcaataacacattgatgtggttaggagtcatttctgag
ccattgcaaatcttaaacactaacatcgccgtttatatcgggattatctacgcctatttg
ccctttatgattttgccgttatacgcgaccttagtgaagttagatatgagcctgattgag
gctgcatctgacttagggtcgagccgtttaaataccttctggaaaatcactttcccgtta
tcgaagagcggagtgattgcaggttcaatgctggtgtttattcctgcggtaggggagttt
gtgatccctgagctgctcggcggcccagattctctgatgataggtaaagtgctgtggcag
gaattcttcaataaccgtgactggcctgtggcctcatcactggcgattgtgatgctggca
ctcttgattattcctattaccttattccatcgctatcaggcgcgtagtttggagaaagac
ctatga

DBGET integrated database retrieval system