KEGG   Shewanella sp. MR-7: Shewmr7_3002Help
Entry
Shewmr7_3002      CDS       T00389                                 

Definition
(GenBank) peptidase C26
  KO
K07010  putative glutamine amidotransferase
Organism
shm  Shewanella sp. MR-7
Brite
KEGG Orthology (KO) [BR:shm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:shm01002]
    Shewmr7_3002
Peptidases [BR:shm01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   Shewmr7_3002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C26 GATase
Motif
Other DBs
NCBI-ProteinID: ABI43986
UniProt: Q0HSB9
Position
complement(3558850..3559611)
Genome map
AA seq 253 aa AA seqDB search
MSVELPLIGVIACNQQLGSHPFNIVGEKYLLGVVNGAKGWPLIIPSLGAEQPIEAILASL
DGILFTGSPSNVEPHLYAGEPSEVGTHHDPKRDATTLPLIRAAIAAGVPVLGICRGFQEM
NVAFGGSLHQKLHEVGGFIEHREDKEASLEVQYGPSHSITVEPGGVIYEAWGRNSAEVNS
VHTQAVERLGIGLRPEAYAPDGLVEAFSVIDANEFALGVQWHPEWKVSENPFFLSIFNAF
GDACRRRATTRVK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgagttgccccttattggtgttattgcgtgtaatcaacaattgggatcgcat
ccctttaatattgttggtgaaaaatacctcttaggtgtagtgaatggtgctaagggctgg
cccttaataatcccctctttaggtgctgaacaacctatagaggcgattctggcaagtctc
gatggcattctctttactggttcgccttcgaatgttgaaccccatctctatgcgggtgaa
ccgagtgaagtcggtactcaccacgatcccaaacgcgatgccaccaccttaccgctgatc
cgtgcggccattgcggcgggtgtgcctgtgctggggatttgtcgtggctttcaagagatg
aacgtcgcttttggtggcagtctgcatcagaagttgcacgaagtgggcggttttattgaa
cacagagaagataaagaggcctcgttagaggtgcaatatgggccatcccacagtatcact
gtggagcctgggggggtcatttacgaggcctggggccgtaactcggcagaggtaaactct
gtacatactcaggccgtggagcgtcttgggattgggttgcggccagaagcttatgctcca
gatggtctagtggaggccttctccgttatagacgcaaatgaatttgccctcggtgtgcaa
tggcatcctgaatggaaggtgagtgaaaacccatttttcctctctatattcaatgctttt
ggtgatgcatgccgtcgtagggctacaactcgagtgaaataa

DBGET integrated database retrieval system