KEGG   Shewanella sp. MR-7: Shewmr7_3003Help
Entry
Shewmr7_3003      CDS       T00389                                 

Definition
(GenBank) transcriptional regulator, XRE family with cupin sensor
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 HTH_3 HTH_19 HTH_31 Cupin_3 Sigma70_r4 HTH_37 AraC_binding MannoseP_isomer HTH_38 MarR HTH_25 HTH_26 HTH_24 CENP-B_N LacI HTH_psq YdaS_antitoxin
Motif
Other DBs
NCBI-ProteinID: ABI43987
UniProt: Q0HSB8
Position
complement(3560004..3560630)
Genome map
AA seq 208 aa AA seqDB search
MFGMMFILNNLFFIYRGNRSFGEMRNLDIGASLRTVRKMKGLSQRELAKRAGVTNSTISM
IEKNSVSPSVSSLKKVLSGIPMSLVDFFSIEASIESEQKVVYRSDELLDIGTGPLEFKLI
GRDFPNRAMSVMSETYPPGSDTGEEMLKHEGEEAAMVIEGKFELTVGDEVYILEAGDSYY
FNSELPHRFRNPFDEPCRLVSATTPANF
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgggatgatgtttatcctgaacaacctgttcttcatctatcggggcaaccgatcc
tttggggagatgcgaaatttggatattggagccagtctcagaactgttcgaaaaatgaaa
ggcttatcccagcgtgagctggctaagcgtgctggtgtgactaacagtacaatttcaatg
atcgaaaaaaacagtgttagcccatccgtcagttctttgaaaaaggtattgtcgggtatc
cctatgtctctagtggattttttctcgattgaagcctcgattgagagtgagcaaaaagtg
gtttatcgctccgatgaactcctcgatataggtactgggccgttagaatttaagttgatt
ggccgtgactttcccaatcgtgccatgtcggtgatgagtgaaacctacccaccgggttcg
gatacgggcgaggaaatgctgaaacacgaaggtgaagaggcggccatggtgatcgaaggc
aaattcgaactgaccgttggcgatgaggtatatatcttagaagcgggtgatagttactat
tttaacagtgagttaccccatagatttcgtaaccctttcgatgaaccctgtcgactggtc
agtgcaacaacgccagcgaatttctaa

DBGET integrated database retrieval system