KEGG   Shewanella sp. MR-7: Shewmr7_3004Help
Entry
Shewmr7_3004      CDS       T00389                                 

Definition
(GenBank) FAD dependent oxidoreductase
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_oxidored Pyr_redox_2 NAD_binding_8 Thi4 FAD_binding_3 FAD_binding_2 Pyr_redox_3 HI0933_like GIDA Pyr_redox Lycopene_cycl Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ABI43988
UniProt: Q0HSB7
Position
3560787..3562094
Genome map
AA seq 435 aa AA seqDB search
MTTKPPVHSEQYPQSYYVDTAKEICAHPQLEGKVSTDVCIIGGGFSGINTAIELRQKGLN
VVLLEAKRIGWGASGRNGGELIRGIGHDPAQFINEIGQEGVSAIEQMGFEAVEIVRNRIQ
THHIDCNLQMGYCDLAVKPRHMHELEQEFDHLKRLGYQHEIKLLTQSQLGEVIGSDFYQG
ALVDMGSGHLHPLNLALGEARVARDLGAQLFEYSAAEKMIPGDKPRVLTAKGEVTCQYVV
LTGNAYIGHKLNSYIGGKVLPAGSYLLATEPLTEAQCQSIIPQNMAFADMRIALDYFHLS
ADRRLLFGGLCTYSGKDPKDIEAALRPNLEKVFPQLKGVRIDYEWGGMIGIGANRMPQIG
RLPDASNIFYAQAYAGHGVNATHMAAKLLAEAICQQAGYFDVFAKIKHMTFPGGPTFRSP
MLAAGMLYHRFKDLF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaaacctcccgttcatagtgaacaatatccccagtcttattatgttgatact
gcaaaagaaatttgcgctcatccccaacttgagggcaaggtaagcactgacgtttgcatt
atcggcggtggtttcagtggtattaacacagctatcgaactgcggcaaaagggcctaaac
gtggtgctactcgaggccaagcgcataggctggggcgcctcagggcgtaatggtggcgag
ctgatccgcgggattggccatgatcctgcgcaatttatcaatgagataggccaggaaggc
gtgagcgccattgagcaaatggggtttgaggcggtagagattgtacgaaatcggatccag
acccatcacatcgattgcaatttacaaatgggctattgcgatctggcggttaaacctcgg
catatgcacgaactagaacaagagttcgaccatcttaaacgccttggatatcagcatgaa
atcaaactattaactcagtctcagctcggagaagttatcggctcagacttttaccaaggc
gccctagtcgacatgggcagcggtcatttgcatccgctgaatttggccttgggcgaggct
cgtgtcgcccgtgacttgggcgctcaattatttgaatacagcgccgcagaaaagatgatt
cctggggataaaccgcgagtattaacggcaaaaggcgaagtgacttgccaatatgttgtg
ctcacgggcaacgcttatattggccataaactgaatagttacatcggcggtaaagtcctg
cccgctgggagttacttgcttgcaactgagccgctgacagaagcgcaatgccaaagcatt
atcccgcaaaatatggcctttgcagacatgcgaatcgccttagattacttccacttatcg
gcggatagacgcttactcttcggcggactttgtacttattcaggcaaagatcctaaggat
attgaagcagcgctcaggccgaacctcgagaaggtattcccacagttaaaaggcgtacgc
atcgattacgaatggggcggcatgataggcattggcgccaaccgtatgccccaaatcggt
cgcctccccgatgcgagtaatattttttacgcccaagcctacgcaggccacggcgtcaat
gccacccatatggctgccaaactactcgccgaagccatatgtcagcaggcgggatatttt
gatgtgtttgccaaaatcaaacatatgaccttccccggcggccccacattccgctcgccc
atgctggctgcgggtatgctgtaccacaggtttaaagacttattctaa

DBGET integrated database retrieval system