KEGG   Shewanella sp. MR-7: Shewmr7_3006Help
Entry
Shewmr7_3006      CDS       T00389                                 

Definition
(GenBank) 3-mercaptopyruvate sulfurtransferase
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00270  Cysteine and methionine metabolism
shm00920  Sulfur metabolism
shm01100  Metabolic pathways
shm01120  Microbial metabolism in diverse environments
shm04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Shewmr7_3006
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Shewmr7_3006
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Shewmr7_3006
Enzymes [BR:shm01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     Shewmr7_3006
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     Shewmr7_3006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-ProteinID: ABI43990
UniProt: Q0HSB5
Position
complement(3562736..3563593)
Genome map
AA seq 285 aa AA seqDB search
MEYPLVSTQWLEEHLTSPDLVLLDASMAVVLGKEPILYSEPVCIPRSRRFDVETDFCDKT
SSQIHALPRFEQFVEGIAKLGIDPQSVVVIYDNQGIYSSPRAWWIFKVMGFHRVYVLDGG
LPQWMAEDRVTSSRYQEEGIDYGASDSEVLTAVLEYQPAKVMDAEAVFAKLNDSGSAIID
ARGAARFLGQVSEPRPGVRCGHIPHSVNLPFAEVLDGFKIKSSAELQTLFQGLAGDKPLR
IFSCGSGITACILILASLASGHADAVLYDGSWADWGSRSDLPIAQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaatatcctctcgtgagtactcaatggctcgaagagcacctcacctcgccagatctc
gtgttactcgatgccagcatggccgtggtgttgggcaaagagcctatcctctattctgaa
cctgtgtgcattccgcgctcaaggcgctttgatgtcgaaacggatttttgcgataaaacc
tcttctcaaatccacgccttaccaaggtttgaacagtttgtcgaaggcattgccaagctc
ggaatagacccgcaaagtgtggtggttatctatgataatcaagggatttattcatctccg
cgcgcttggtggatattcaaggtgatgggatttcaccgtgtgtatgtgctcgacggtggt
ttaccccaatggatggctgaagacagagttacctcatcccgctatcaggaagaagggata
gattatggtgcaagtgatagtgaagtactcactgctgtattggaatatcagcctgccaag
gtgatggatgccgaggccgtgtttgccaagcttaatgatagcggcagcgcgattatcgat
gcccgcggcgccgcccgctttttaggccaagtgagtgagccacgcccaggtgtgcgttgt
gggcatattccccattcggttaatttaccttttgcagaggtgctcgatggcttcaaaatc
aaaagctcggcagaattacaaaccctgtttcaagggcttgctggtgataaaccgttaagg
attttcagctgtggctcgggcattaccgcctgtatcttaatccttgcgtcactcgcttct
ggccatgccgatgctgtgctctacgatggctcttgggccgattggggcagtcgcagcgat
ttacccatagcacaataa

DBGET integrated database retrieval system