KEGG   Shewanella sp. MR-7: Shewmr7_3009Help
Entry
Shewmr7_3009      CDS       T00389                                 

Definition
(GenBank) aminotransferase
  KO
K00822  beta-alanine--pyruvate transaminase [EC:2.6.1.18]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00280  Valine, leucine and isoleucine degradation
shm00410  beta-Alanine metabolism
shm00640  Propanoate metabolism
shm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Shewmr7_3009
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shewmr7_3009
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Shewmr7_3009
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:shm01007]
    Shewmr7_3009
Enzymes [BR:shm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.18  beta-alanine---pyruvate transaminase
     Shewmr7_3009
Amino acid related enzymes [BR:shm01007]
 Aminotransferase (transaminase)
  Class III
   Shewmr7_3009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABI43993
UniProt: Q0HSB2
Position
3566073..3567413
Genome map
AA seq 446 aa AA seqDB search
MADSPYNTTHEHPSLEHYWMPFTANRQFKASPRLLAQAEGMYYTDINGNKVLDSTAGLWC
CNAGHGRREISEAVSKQIREMDYAPSFQMGHPLAFELAERLTELSPEGLNKVFFTNSGSE
SVDTALKMALCYHRANGQASRTRFIGRELGYHGVGFGGISVGGLSNNRKAFSGQLLQGVD
HLPHTLDIQNSAFSRGLPSLGAEKAEVLEQLVTLHGAENIAAVIIEPMSGSAGVILPPQG
YLKRLREITQKYGILLIFDEVITAFGRVGAAFASQRWGVIPDIITTAKAINNGSIPMGAV
FVQDFIHDTCMQGPTELIEFFHGYTYSGHPVAAAAALATLSIYENEQLFERSFELERYFE
DAVHSLKGLPNVIDIRNTGLVAGFQLAPNSQGVGKRGYSVFEHCFHQGTLVRATGDIIAI
SPPLIVEKHQIDQIVNSLSDGIRAVG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggccgattcaccctacaacacaacacatgagcatccttctctcgaacattattggatg
ccctttaccgccaaccgccagtttaaagccagccctcgcctgctcgcccaagcagaaggc
atgtactacacggatatcaatggtaataaggtactagactcaacggctggcttgtggtgt
tgtaacgccggccatggacgccgtgagatcagcgaagccgttagcaagcaaattcgcgag
atggattacgcaccgtccttccaaatgggtcatcccctcgccttcgaactcgccgagcgg
ttaactgaactcagccctgaaggactcaataaggtcttctttaccaactcgggatcagag
tccgtcgataccgcgcttaaaatggcactctgttaccacagagctaatggccaagcgtca
cgtactcgctttattggccgtgagctgggctaccatggcgtaggatttggtggcatttca
gtgggaggcttgagcaataaccgtaaagcctttagtggccaactgctgcaaggcgtggat
cacctgccccacaccttagatattcaaaattcagcctttagccgtggcttacctagccta
ggtgccgaaaaagccgaagtattagaacaactcgtcacactccacggcgccgagaatatt
gccgccgttatcattgagcccatgtcgggttcggcgggggtgattttaccgccacagggt
tacttaaagcgcctacgggaaatcacccaaaaatacggcatcctattgatttttgatgag
gtgatcactgcctttggtcgcgtcggcgccgcctttgccagccagcgctggggcgttatc
cccgacataatcactacggccaaggccattaataatggttcgatcccaatgggcgccgtg
tttgtgcaggattttattcacgatacctgtatgcaaggccccaccgaactcatcgagttt
ttccacggttatacctattcagggcatccagtagcggcggccgcggcgctcgctacgctg
tccatctatgaaaacgaacagctatttgaacgcagcttcgaacttgagcgttatttcgag
gatgccgttcacagtctcaaaggtttgccgaatgtgattgatattcgcaacaccggattg
gtagcaggcttccaactcgcgccgaatagtcaaggcgtcggtaaacgcggttacagcgtg
ttcgaacattgtttccatcaaggcacgctcgtgcgggcgacgggcgatattatcgccata
tccccaccgttaatcgtagagaaacaccaaatagaccaaatagttaacagcctaagcgat
ggaattcgcgccgtaggatga

DBGET integrated database retrieval system