KEGG   Shewanella sp. MR-7: Shewmr7_3022Help
Entry
Shewmr7_3022      CDS       T00389                                 

Definition
(GenBank) SapC family protein
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SapC
Motif
Other DBs
NCBI-ProteinID: ABI44006
UniProt: Q0HS99
Position
complement(3583254..3583943)
Genome map
AA seq 229 aa AA seqDB search
MKTQFVPLNDSSHKNLAIGDKVDYSYFETVHMLPLQVQEFMSAATSFPIVFTKNNQTGEF
VSIAITALKPNTNKLLKNGQWQSRYLPIQVQLYPLGMTHVDEEKIILGIDINNSSVAENE
THRLFTEAGEKTDYLSKKLELAGLQASYQDTTKYFIKVLLEHELLQPRTLTVTALDGTKT
NIDGIYTIDEPKLQQLDDATLLNFAKRGFYSAIYAHLCSLSLIDLVMDR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacaatttgtacctttaaatgactcgagtcataagaatttggctattggtgat
aaggtcgattacagctactttgaaactgtgcatatgctaccactgcaagtgcaagagttt
atgtcggctgctacaagctttcctattgtatttacaaagaataaccaaactggcgagttt
gtctctatagcgattaccgcgctaaaaccgaataccaataagctgctaaaaaatgggcag
tggcaatcacgatacttacctattcaagtgcagctgtatccactaggtatgacccatgtc
gatgaggaaaagattatcttaggtatcgacattaacaactcatccgtggctgaaaatgaa
actcaccgattatttactgaggctggtgagaaaacggactacttgtccaagaagctcgaa
ctcgcgggtttacaagctagctatcaagatacgacgaagtactttatcaaagtattgttg
gagcatgagttattacaaccaagaacacttacagtgacggcgctggatggtacgaaaacc
aacatcgacgggatctataccattgatgagcctaaactacagcagcttgatgatgcgact
ttgctgaatttcgcgaaacgaggtttttattcggccatttatgcgcatctttgttcatta
agtttaattgatttagtgatggatagataa

DBGET integrated database retrieval system