KEGG   Shewanella sp. MR-7: Shewmr7_3024Help
Entry
Shewmr7_3024      CDS       T00389                                 

Definition
(GenBank) TonB-dependent receptor
  KO
K02014  iron complex outermembrane recepter protein
Organism
shm  Shewanella sp. MR-7
Brite
KEGG Orthology (KO) [BR:shm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shm02000]
    Shewmr7_3024
Transporters [BR:shm02000]
 Other Transporters
  Pores ion channels [TC:1]
   Shewmr7_3024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_dep_Rec Plug OMP_b-brl_3
Motif
Other DBs
NCBI-ProteinID: ABI44008
UniProt: Q0HS97
Position
complement(3585601..3588225)
Genome map
AA seq 874 aa AA seqDB search
MRPSSFKKSVLATNIAILLGSAVSIGAVAAEAEATAAAAENIEKIEVRGMRASMKASVND
KRFSDSVVDAVTAEDIGKFPDGDVGESLGRIPGVAVNRQFGQGQQVSIRGASSQLTSTLL
NGHSVASTGWFDQQAIDRSFNYSLLPPEMVGGIQVYKSSQADIAEGGIGGTVIVKTRKPL
DLEANSVFLSAKGDYGTVSEEIDPQTSGLYSWKTEDEKFGFLVAGSLDQTQYQRNGIETL
LGWGEIVPTTFQQDRERTALNAVFQYRPTDNLEFGLNLMSLQLDANNANTSIFLFPTQQG
ENTCLKENAAGVCTLVEHTGNGGFAWAQTWARKASMSSDTVDLDFAYQADNYKLEGRIGK
TKAEGGTDLTSNYGQSIGKPEDFAGTYDATGDVIDINIANNSFDAGDFNGQLETAGWALK
KQPNTDEESFATFDITVPVEFGVITSIKSGISYADHDVTQTTEAAQSSNIVAKDASEYYS
GTMSSGAGFTLPKPIFDNMIRDAYGAIDGFTLDKSGYGTLQEKNLALYTMATFAGEGVRG
NFGLRYISTDVESDYYAFSQTGTYADDLSTDKASYHDVLPSMNIAFDLASDLILRASAAQ
VISRPNYADLFATSKLPGFNDGTPGNEKKVTGSVNLQPFKASQADLSLEWYFSGEGLFAV
TYFIKDVNSFISTREKLNQQIGIDDPNLVAQGGSSCGAGIYDCWTVSENYNANGGSIDGI
ELQLQDSFDNGFGYSANYTFADASSPAENYADRVGVFSDSSKHTVNLVGYYEIDDFSARV
AYNWRSEYMMRELPGFYGNREHQAYGTLDLSANYDVTDYLSVTFEVVNLLEEDSIQKGVS
PVDAEGVISEFKDNYPVWSFDGEARYKLGVALRF
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccatcatcctttaagaaaagtgtactagctacaaacattgctatcctactcggc
agcgctgtttcaatcggagctgttgctgcagaagctgaagccactgcagctgctgctgaa
aatattgagaaaattgaagttcgtggtatgagagcttcgatgaaagcttctgttaacgac
aaacgtttttctgactctgtcgttgatgcggtaactgctgaagatatcggtaaattccct
gatggtgacgtaggggagtccttaggtcgtattcctggcgttgctgtaaaccgtcagttt
ggtcaaggacagcaagtttctatccgtggcgcttcaagccaattaacgagcacgttactg
aacggccattcagttgcttcgactggttggtttgaccagcaagcgatcgaccgtagcttt
aactacagcttactgcctccagaaatggttggtggtattcaagtttataaatcatctcaa
gcagatatcgctgaaggtggtatcggcggtactgtaattgttaaaactcgtaaaccttta
gatttagaggccaactcagtcttccttagtgcgaaaggggattacggaaccgtttcagaa
gaaattgacccacaaacttcaggtttgtacagctggaaaacagaagatgagaagtttggt
ttcctagtggctggttctctggatcaaacacaatatcaacgtaacggtattgaaactctg
ttaggttggggcgagattgttcctacgactttccagcaagaccgcgagcgcacagcttta
aacgcagtattccaatatagaccaactgataacctcgagttcggtctgaatttaatgagc
ttacagctcgatgctaacaacgccaacacatcaattttcttattcccaactcaacaaggt
gaaaatacttgtcttaaggaaaatgctgcaggcgtatgtactttagttgaacacacaggt
aacggcggatttgcttgggcacaaacatgggctcgtaaagcaagtatgtcatcagacact
gtggacttagatttcgcttatcaggctgataactataagttagaaggccgtatcggtaaa
actaaagctgaaggtggtaccgatcttacttctaactacggtcaatcaattggtaaacca
gaagatttcgcagggacttacgatgcaactggtgatgtgattgacatcaacattgcaaat
aactcatttgatgcgggtgacttcaacggtcaattggaaacagctggttgggcattgaaa
aaacaacctaacacggacgaagaatcatttgcgaccttcgatattactgttccggttgaa
tttggcgttattacctctattaaatcaggtattagctatgcagaccacgatgtaactcaa
acgactgaagctgcacaatcatctaatatcgtcgcaaaagatgcctctgaatattactct
ggcactatgtcatctggcgctggttttaccttacctaagccaatttttgacaatatgatc
agagatgcttatggcgctatcgatggctttactttagataagtctggttacggtacactg
caagagaaaaacttagccctgtacactatggctacttttgctggtgaaggtgtgcgtggt
aacttcggtttaagatatatctctaccgatgttgagtctgactactacgcgtttagccaa
actggtacttatgctgatgatttaagtactgataaggcaagctatcacgatgtattacca
agcatgaacattgcgtttgacttggcaagtgacttaattttaagagcatcagctgcacaa
gttatttctcgtcctaactatgcggatctcttcgcgacgtctaagttaccaggtttcaac
gatggtacgccaggcaacgagaagaaagtgactggtagcgtgaatctgcagccgttcaaa
gcctcacaggctgatctgagcttagaatggtacttcagcggtgaaggattatttgctgtt
acttacttcattaaagatgttaactctttcatttcgacaagagaaaagctgaaccaacag
attggtattgatgatcctaacttagttgcgcaaggtggcagttcttgtggtgcaggcatt
tacgactgctggaccgtcagtgagaactacaatgctaacggtggttctatcgatggtatt
gagttgcagttgcaagactcatttgacaatggttttggttactcagctaactacaccttt
gcagatgcttcatctccagctgaaaactatgcggaccgtgtaggggtgttctcagactca
tctaagcatactgttaacttagtgggttactatgaaatcgatgatttctctgctcgtgta
gcttataactggcgttctgagtacatgatgcgcgaattaccaggcttctacggtaaccgc
gagcatcaagcctacggcacgttagatttaagtgctaactacgatgtaactgattactta
tctgtgacatttgaagtggttaacttacttgaagaagatagcattcagaaaggtgtatca
cctgttgatgctgaaggcgttatcagtgagtttaaagataactacccagtgtggagcttc
gatggtgaagctcgctacaaacttggtgtagcactgcgcttctaa

DBGET integrated database retrieval system