KEGG   Shewanella sp. MR-7: Shewmr7_3028Help
Entry
Shewmr7_3028      CDS       T00389                                 

Definition
(GenBank) methylation site containing protein
  KO
K08084  type IV fimbrial biogenesis protein FimT
Organism
shm  Shewanella sp. MR-7
Brite
KEGG Orthology (KO) [BR:shm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:shm02044]
    Shewmr7_3028
Secretion system [BR:shm02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Shewmr7_3028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GspH N_methyl
Motif
Other DBs
NCBI-ProteinID: ABI44012
UniProt: Q0HS93
Position
3591787..3592299
Genome map
AA seq 170 aa AA seqDB search
MKTLPHGFSLIELITTVSISTILLSIGAPSLSDFNTRFRADSNIKVIQQTLMLARNHAIS
FNRKVTVCALSNNQCTSNWQLGLTVFIDVNSNSQLDGNETTIFTTNAFNARDTVIYNRTL
IRFQPDGLASGTNGTLKYCPSSPTSPYSRGIVVNQAGRARLSTDANIRCG
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactctaccacatggctttagcttgattgaactcatcactacggtatccatttct
accattctgttatcgattggtgctccctcgttaagcgatttcaacacgagattcagggct
gatagtaatatcaaagtcatccagcaaacactgatgctcgcccgaaatcatgctatttcc
ttcaatcgaaaagtgactgtctgtgccttaagcaacaatcagtgcacatctaactggcag
cttggtttaacagtatttattgatgttaacagcaatagtcaactcgatggcaatgaaacg
actatttttaccactaacgcttttaatgccagagatacagttatctacaatcgaacctta
attcgttttcaaccagatggtcttgcctctggtactaatggaacattgaagtattgccca
tcaagtcccaccagcccatactcacgagggattgtggtaaatcaagctggcagggcaaga
ctatcgactgatgccaatatccgctgcggataa

DBGET integrated database retrieval system