KEGG   Shewanella sp. MR-7: Shewmr7_3031Help
Entry
Shewmr7_3031      CDS       T00389                                 

Definition
(GenBank) methylation site containing protein
  KO
K02655  type IV pilus assembly protein PilE
Organism
shm  Shewanella sp. MR-7
Brite
KEGG Orthology (KO) [BR:shm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:shm02044]
    Shewmr7_3031
   02035 Bacterial motility proteins [BR:shm02035]
    Shewmr7_3031
Secretion system [BR:shm02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Shewmr7_3031
Bacterial motility proteins [BR:shm02035]
 Pilus system
  Pilus assembly proteins
   Shewmr7_3031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComP_DUS N_methyl Pilin_GH
Motif
Other DBs
NCBI-ProteinID: ABI44015
UniProt: Q0HS90
Position
complement(3593246..3593647)
Genome map
AA seq 133 aa AA seqDB search
MNTEQQKGFTLIEVMITVVIIGILASIAYPSYTNYITRSARSEGVAAVMRVANLQEQYYL
DNRAYATDMTKLGLSANPFVTEHGHYSLASAVSSGTLTITATALGVQYSRDSVCKTITMT
SAGAKGPSPECWK
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgaacaacaaaagggatttacattaatcgaagttatgatcactgtcgtgatt
attgggattttagcctctatagcttatccttcttatactaattacattacacgaagtgct
cgctctgaaggggttgcagcagtcatgagagttgctaatctacaggagcagtattatttg
gataatcgtgcatatgcaactgatatgacaaaacttgggctatctgctaacccttttgtt
actgaacatggacattatagtcttgcatcagcagtcagcagcggtactttaactataact
gctacagcacttggcgttcagtatagccgggattcggtttgtaaaaccattacaatgaca
tcagctggtgccaaaggtccttctccggagtgttggaaatga

DBGET integrated database retrieval system