KEGG   Shewanella sp. MR-7: Shewmr7_3033Help
Entry
Shewmr7_3033      CDS       T00389                                 

Definition
(GenBank) type IV pilus assembly protein PilX
  KO
K02673  type IV pilus assembly protein PilX
Organism
shm  Shewanella sp. MR-7
Brite
Secretion system [BR:shm02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Shewmr7_3033
Bacterial motility proteins [BR:shm02035]
 Pilus system
  Pilus assembly proteins
   Shewmr7_3033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PilX_N DUF5325
Motif
Other DBs
NCBI-ProteinID: ABI44017
UniProt: Q0HS88
Position
complement(3597303..3597773)
Genome map
AA seq 156 aa AA seqDB search
MKKQKGVVLFFALIVLIIMTVIGVALAVNSTQSLRMAGAGSERVEAKALADGGVDAVLNA
KTKAFLATMTAIDSNNNYSGGRQTLTPLPLVDDGTGTLVVQPKNVSCQRSLNASGTDLFK
CRRVEISSAVAFGRDNVGQLTVITGIQQEVLTGSGS
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcaaaagggtgtcgtgttattttttgccttgatagtcctgatcattatgact
gtgattggtgttgcactggctgttaattccactcaatcactaagaatggctggggctggt
tccgagcgagttgaggcaaaagctttagctgatggcggcgtggacgcagtgttgaatgca
aagacaaaagcatttcttgcaacaatgacagcaatagattcgaacaataactattcagga
gggagacaaacattaactcccttaccattagttgacgatggaacaggaacattagttgtt
cagcctaaaaatgtttcttgtcagcgtagtctaaatgcaagtggtacagatttattcaaa
tgccgaagagtggaaatttctagcgctgttgcatttggtagggataatgtggggcaactc
actgttattacaggtatccagcaagaagtgttaactgggagtgggtcatga

DBGET integrated database retrieval system