KEGG   Shewanella sp. MR-7: Shewmr7_3034Help
Entry
Shewmr7_3034      CDS       T00389                                 

Definition
(GenBank) Prepilin-type cleavage/methylation-like protein
  KO
K02672  type IV pilus assembly protein PilW
Organism
shm  Shewanella sp. MR-7
Brite
KEGG Orthology (KO) [BR:shm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:shm02044]
    Shewmr7_3034
   02035 Bacterial motility proteins [BR:shm02035]
    Shewmr7_3034
Secretion system [BR:shm02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Shewmr7_3034
Bacterial motility proteins [BR:shm02035]
 Pilus system
  Pilus assembly proteins
   Shewmr7_3034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PilW N_methyl
Motif
Other DBs
NCBI-ProteinID: ABI44018
UniProt: Q0HS87
Position
complement(3597785..3598786)
Genome map
AA seq 333 aa AA seqDB search
MKCSVTLATTHSARTNQRGLSLVELMVAMVIGLFLTAGVFTMFSMSSSNVTTTSQFNQLQ
ENGRIALAILERDLTQLAFMGDMTGTDFILGINTTLEAAVAKDCIGAGLNNETLPNNQPA
HFRRLWGYENKSNSATLSCLPYDEVNPNTDVIQLKRFIGPSLLAGLTSGFNVATNTSQAV
FFKGAAPTTVTLENARTWEFQHHVYFIADDAGGIPVLRRKTLTDTGMSGEEQLVEGIENI
RFLYGFDNDGDSTPDSFMPAEKVSSLMWDNEGFQRLVAIKVYLMVRSINEDRSYTNETIY
QLGDKQIKGLNDHYRRKILSTTVVLENPVLIRS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgttcagtaacgttagccactactcattcagctagaaccaaccaacgaggttta
tcactcgtcgagttaatggttgctatggttattggtctgtttttaactgctggcgttttt
acgatgttcagtatgtcttcttctaatgtcaccaccactagtcagtttaatcaattgcag
gaaaatggccgtattgctttagctatattagaacgtgatcttactcagttagcctttatg
ggggatatgacgggtacagattttattctcggtattaatacaacattagaggctgcggtt
gctaaggattgcattggtgcaggattaaataatgagacgttgccaaataatcaacctgca
cattttagacgcctttggggatatgaaaataaaagtaactcagccacattaagctgttta
ccttatgatgaagtgaacccaaatacggatgttattcaattaaaaagatttatcggcccc
agtttgttagcaggcttgactagtggttttaatgtagcaacgaatacctctcaagcagta
ttttttaaaggtgcagctccaaccacagttacgttagaaaatgctagaacatgggagttt
caacatcatgtttattttattgcagatgatgcgggtgggataccagttctaaggcgtaaa
actctcactgatacgggaatgagtggcgaggagcagctcgttgaaggtattgagaatatt
cggtttctttatggttttgataatgatggggatagtacacctgacagttttatgcctgct
gaaaaagtttcgtctttaatgtgggacaacgagggattccagcgtctagtggctatcaaa
gtgtatttaatggttcgttcaataaatgaagatcgtagttataccaatgaaacgatttat
cagcttggtgataagcaaattaaaggattgaacgatcattatcgtcgtaaaattttgtcg
acgacagtcgtattagaaaaccctgtgttgattcgaagttaa

DBGET integrated database retrieval system