KEGG   Shewanella sp. MR-7: Shewmr7_3038Help
Entry
Shewmr7_3038      CDS       T00389                                 

Definition
(GenBank) signal peptidase II. Aspartic peptidase. MEROPS family A08
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
shm  Shewanella sp. MR-7
Pathway
shm03060  Protein export
Brite
KEGG Orthology (KO) [BR:shm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Shewmr7_3038
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:shm01002]
    Shewmr7_3038
Enzymes [BR:shm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     Shewmr7_3038
Peptidases [BR:shm01002]
 Aspartic Peptidases
  Family A8: signal peptidase II family
   Shewmr7_3038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_A8 MscL
Motif
Other DBs
NCBI-ProteinID: ABI44022
UniProt: Q0HS83
Position
complement(3600943..3601455)
Genome map
AA seq 170 aa AA seqDB search
MPLTWKDSGLRWYWVVVLVFLADQLSKQWVLANFDLFESVKLLPFFNFTYVRNYGAAFSF
LSEAGGWQRWLFTLVAVGFSTLLTVWLRKQSASLWKLNLAYTLVIGGALGNLIDRLMHGF
VVDFIDFYWGKSHYPAFNIADSAIFIGAVLIIWDSFFNSKSEQDKTEEVK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgccattaacttggaaagacagtggcttacgttggtattgggtagttgtattggtgttt
ttggccgatcaactatccaaacaatgggtcttagccaattttgatttgttcgaatcggtg
aagttattacctttttttaatttcacctatgtacgtaactatggcgccgcatttagcttt
ttaagtgaagcaggcggttggcaacgttggttatttaccttagtggctgttggtttcagt
accttgttgactgtgtggctgcgcaagcaatcggcatccctatggaagttaaacttggct
tacaccttagtgattggtggcgccctaggtaacttaatcgatcgattgatgcacggtttt
gtggtggattttatcgatttttattggggtaagagccattatcccgcctttaatatcgcc
gattccgcgatttttatcggcgcagtgctgatcatttgggattcgttttttaacagcaaa
tccgaacaagataaaaccgaagaggtgaagtag

DBGET integrated database retrieval system