KEGG   Shewanella sp. MR-7: Shewmr7_3041Help
Entry
Shewmr7_3041      CDS       T00389                                 

Definition
(GenBank) integral membrane protein MviN
  KO
K03980  putative peptidoglycan lipid II flippase
Organism
shm  Shewanella sp. MR-7
Brite
Peptidoglycan biosynthesis and degradation proteins [BR:shm01011]
 Precursor biosynthesis
  Flippase
   Shewmr7_3041
Transporters [BR:shm02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Shewmr7_3041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MVIN Polysacc_synt_C ApoO
Motif
Other DBs
NCBI-ProteinID: ABI44025
UniProt: Q0HS80
Position
complement(3605321..3606880)
Genome map
AA seq 519 aa AA seqDB search
MSKKLLKSGMIVSAMTLISRVLGLVRDVVVANLMGAGTSADVFFFANKIPNFLRRLFAEG
AFAQAFVPVLTEYQEKHTSDETRELLSKVAGTLGLLVTIVTLVGVIASPVLSALFGGGWF
VAWLNNEPDGAKFELATVVLKITFPYLWFITFTALAGSILNTRGRFAVSAFTPVFLNVAI
ITAAMFFAPTSSQPEITLAWGVFCGGLIQFLFQIPFLLREKALVKPSWGWKHPGVVKIRT
LMIPALFGVSVSQINLLFDTFIASFLMTGSISWLYYSDRLLEFPLGLFGIAIGTVILPAL
SRNHVNAEGDGFGKTMDWGIKAILLLGLPAMMGLIVLAQPMLMVLFMRGAFSIQDVEMAS
YSLMAYGSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMITNMGFNLIFAIPFGYVGLA
IATSMSALLNATLLYRGLHKAGVYRISKPTMVFFLKAVVSAALMVVVLYYFLPSQSQWLE
WQLVGRAKTLIGLIAVGAMTYLLGLLALGIRPWSMKRGV
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaaaaattattgaaatctggcatgattgttagtgctatgacgttgatttctcgt
gttttaggtttggttcgagatgtagttgttgccaatttaatgggggcagggacaagcgcc
gacgtttttttcttcgccaataaaattcctaactttttacgtcgattatttgccgagggc
gcttttgctcaggcatttgttccggtactgaccgaatatcaggaaaaacacacttcggac
gagactcgagagttactcagtaaagtggcggggaccttagggctattggtgacgattgta
actcttgtcggagtcatcgcatcccccgtattgtcggccttatttggtggcggctggttt
gtggcttggcttaacaatgagcccgatggcgccaagtttgagctggcaaccgttgtgctt
aaaatcaccttcccgtatttgtggtttatcacctttaccgcgttagcagggtccatccta
aatacccgtgggcggtttgcggtatcagcatttaccccagtattcttaaacgtggccatt
attacggcggcgatgttttttgcacctacgtcttctcagcctgaaattaccttggcatgg
ggggtattttgtggtggtttaattcagtttttattccagatccccttcctacttagagaa
aaggctctcgttaaaccgtcatggggctggaaacaccctggggtcgtgaagatcagaact
ctgatgatccctgcgctttttggtgtgtcggtttcacaaatcaatctgttattcgatact
tttatcgccagcttcctgatgacgggctctatcagctggttgtactattcggaccgttta
ttggaatttccactcggtttatttggtattgccattggtaccgtgattttaccggcttta
tctcgaaatcatgtaaatgcagaaggtgatggctttggtaaaaccatggattggggcatc
aaggcgattctgttattaggattacccgccatgatggggctgattgtgctcgcccaacct
atgttgatggtgctgtttatgcgcggcgccttctctatccaagacgttgagatggcatcc
tacagcttgatggcttatggcagtggtttactcagctttatgcttattaaagtgttagcg
ccaggatattactcgcgccaagacactaagactcctgtgcgttacggtattatcgctatg
attaccaacatgggctttaacctgatctttgcgattccctttggttatgtcggcttagcg
attgcgacatcgatgtcagctttactgaatgccactcttttatatcgcggtctacacaag
gcgggtgtttaccgaatttctaaaccaacaatggtgtttttccttaaagccgtggtttcg
gcagccttgatggtggtagtcttgtactacttcttaccttcgcaatcccaatggttggaa
tggcagctggttgggcgtgctaagactttgattggtttgattgctgttggcgctatgacg
tatttacttggcttgttggcgttaggaattcgtccttggtcaatgaaacggggagtttga

DBGET integrated database retrieval system