KEGG   Shewanella sp. MR-7: Shewmr7_3042Help
Entry
Shewmr7_3042      CDS       T00389                                 

Definition
(GenBank) SSU ribosomal protein S20P
  KO
K02968  small subunit ribosomal protein S20
Organism
shm  Shewanella sp. MR-7
Pathway
shm03010  Ribosome
Module
shm_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:shm00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Shewmr7_3042
Ribosome [BR:shm03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    Shewmr7_3042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S20p DUF4798
Motif
Other DBs
NCBI-ProteinID: ABI44026
UniProt: Q0HS79
Position
3607133..3607399
Genome map
AA seq 88 aa AA seqDB search
MANSKSAKKRALQSEKRRQHNASRRSMLRTYVKKVIAAIKAGDHKTATEAFAAAQPIVDR
MATKGLIHKNKAARHKARLNAKIKALAA
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
ttggctaatagcaagtctgcaaagaagcgcgcgcttcaatctgaaaagcgtcgtcagcac
aacgccagccgtcgctcaatgttacgtacatacgttaaaaaagttatcgctgctatcaaa
gctggcgatcacaaaacagcaaccgaagctttcgctgctgcacaaccaatcgttgaccgt
atggcgactaaaggccttattcacaagaataaagctgcccgtcataaggctcgtttgaat
gctaagatcaaagcactagctgcttaa

DBGET integrated database retrieval system