KEGG   Shewanella sp. MR-7: Shewmr7_3043Help
Entry
Shewmr7_3043      CDS       T00389                                 

Definition
(GenBank) transcriptional regulator, ArsR family
  KO
K22042  ArsR family transcriptional regulator, virulence genes transcriptional regulator
Organism
shm  Shewanella sp. MR-7
Brite
KEGG Orthology (KO) [BR:shm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shm03000]
    Shewmr7_3043
Transcription factors [BR:shm03000]
 Prokaryotic Type
  Helix-turn-helix
   ArsR family
    Shewmr7_3043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_5 HTH_20 HTH_34 HTH_24 MarR_2 MarR TFIIE_alpha HxlR DUF2582 TrmB DUF2089 Rrf2 HTH_1
Motif
Other DBs
NCBI-ProteinID: ABI44027
UniProt: Q0HS78
Position
complement(3607460..3607756)
Genome map
AA seq 98 aa AA seqDB search
MNIELMQERADHAVVLLKALANERRLFILCYLLNEGEMCVGEMNKKLGLSQSALSQHLAW
LRKDNLVTTRKEAQTVFYSLKSDEVREMIHLLNNIYCH
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgaattgatgcaggagcgagccgatcatgccgtagtgctactaaaagcactc
gcaaacgaacgccgtttatttatcctttgttatttattgaacgaaggtgaaatgtgtgtt
ggcgaaatgaataaaaaattaggcttaagtcaatcggcactatcacaacaccttgcttgg
ttgcgcaaagataatttagtaaccacacgcaaagaagcgcaaaccgtattttattcgctt
aagagtgatgaagtgcgtgagatgatccatttactgaacaatatttattgtcattaa

DBGET integrated database retrieval system