KEGG   Shewanella sp. MR-7: Shewmr7_3047Help
Entry
Shewmr7_3047      CDS       T00389                                 

Definition
(GenBank) Phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00030  Pentose phosphate pathway
shm01100  Metabolic pathways
shm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Shewmr7_3047
Enzymes [BR:shm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Shewmr7_3047
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Shewmr7_3047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP XFP_C
Motif
Other DBs
NCBI-ProteinID: ABI44031
UniProt: Q0HS74
Position
3612150..3614516
Genome map
AA seq 788 aa AA seqDB search
MTTTHEINALKKYVRATNFLATSQIYLKQNVLHKRPLAHSDIKPRLLGHWGTCPGINFVY
ANVNRLIVKHNRPFIYLVGPGHGFPAVQANLFIEGSLSHFYPETIPYNETGIEDICKKFS
AAYGYPSHANPEAPGQILEGGELGYSLSVGWGAVLDNPDLIATVLVGDGESETGPLAASW
YANRLVSPATNGAVLPIVHINGYKISGPTRMGRMSHEELDLEFRGLGYHPIIVDSEAEED
IYIQMATAMDTAYSMINDIQTRARKGEDIVKPRWPVILMRTAKGWTGVSEYNGTKLEGNC
ESHQVIVNKCATDKGHLAALDSWLASYQFQELYQINGQGELIFDADISSLIPPKHLACGR
QHLTYGGEVVRALSNPDLEKLSYGPEVPRGHRGYSMLKMGQWMRDAFKLNRDQRNLRIFS
PDETYSNQLQAVFEETDRAWQWPIESWDEDMSRDGRVLELLSENLLFGMLHGYTVTGRHG
MFPTYESFSQVVSSMADQYCKYVYASQGVHFRKPLPACNVVLSSLLERQDHNGYSHQNPS
FLGAMLEKHPKIISAYLPADANSTLVYTERAFADRDKLNILVAGKKELPQWLSLEEARKQ
AKDGVMVWDFASDENPDIVLAGCGDYVTQECMASLVIIRELLPRVRIRFVSVTELSSDGL
GSRKFKEKPWMMDEIFTQDKGVVFNYHGYPNTIKKLIFDYKGSRRFRIKGYEEEGSTTTP
FDMGVRNGTSRYHLVIDMAYKLFQQGVIDETKHVSITTDMLQRLVDHRNYIKANGVDPVE
IENWIWTR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgacgactacacatgaaattaatgctcttaaaaagtatgtaagagccacaaacttcctc
gctacgtctcagatttatctaaaacaaaacgtattgcacaaacgcccccttgcgcattcg
gacattaagcctcgtttgctcggtcactggggaacttgtccaggtatcaactttgtctat
gccaacgtcaaccgactcattgtaaaacataatcgtcctttcatttacttagttggccca
ggccatggcttccctgctgtacaagctaacttattcattgaaggctcactcagccacttc
tacccagaaaccattccttataatgaaaccggcatcgaagatatctgtaagaagttttct
gcagcctatggttatccttcccatgcaaacccagaagcacctggtcaaatccttgaaggc
ggcgaattaggttattcattatcagttggctggggcgcagtattagacaacccagatctt
atcgctacagtattagttggtgacggtgaatcagaaactggtcctctggcagcatcttgg
tatgccaaccgcttagtttcacccgcaaccaacggtgctgtattgcctatcgtacatatc
aacggttataagatttcaggccctacccgtatgggacgcatgagccatgaagaattagat
cttgaattccgcggtcttggctaccacccaattattgttgacagcgaagcggaagaagat
atctacattcagatggcgaccgccatggataccgcttatagcatgatcaacgatattcaa
actcgagcacgtaagggtgaagatattgtcaaacctcgctggccagtgattttaatgcgt
accgccaagggctggacaggtgtgagcgaatataacggtacgaaattggaaggtaactgc
gagtcgcaccaagttatcgtcaataaatgtgccactgataaaggccacttagctgcgctg
gatagctggttagccagttatcaattccaagagctttaccaaatcaacgggcagggtgaa
ctgatttttgatgccgatattagctcactgatcccgccaaagcatttagcttgcggtcgc
caacatctcacttatggtggtgaagtcgtcagagccttatctaatccagatctagaaaag
ctcagctatggcccagaagtgccacgtggacaccgcggttactctatgctgaaaatgggt
caatggatgcgcgacgcattcaaattgaaccgtgatcaacgtaacttacgtatcttcagc
ccagatgaaacctattcaaaccagctgcaagcagtatttgaagaaaccgaccgcgcatgg
caatggccaattgaaagctgggacgaagacatgtctcgcgatggtcgagtactcgagttg
ctctcagagaacttactgtttggtatgctgcatggctacacagtgacgggacgtcacggt
atgttccctacctatgagtctttctcacaggtcgtatcctccatggctgaccaatattgt
aagtatgtttacgccagtcaaggagtgcatttccgtaagcctttaccggcgtgcaacgtg
gtactttcttcattattagaacgtcaagatcacaacggttattcgcaccagaacccatca
ttcctaggtgcgatgcttgaaaaacatccaaagattatttctgcttatttacccgcggat
gctaacagcaccttagtttataccgaacgtgcttttgcggatcgtgacaaattgaacatc
ctagtcgcaggtaaaaaagaactgccacaatggctcagtttagaagaagcgcgaaaacaa
gctaaagacggcgtcatggtgtgggattttgcttccgatgaaaatccagatatcgtgctt
gcaggttgtggtgattatgtcactcaagaatgtatggcctctttagtgattattcgtgaa
ctattacctagagtcagaattcgctttgtcagcgtgacagaattaagcagtgatggttta
ggtagtcgtaaatttaaagaaaaaccatggatgatggatgaaatatttacccaagataaa
ggggtagtatttaactatcacggttatccaaatacgatcaaaaagttaatatttgattac
aaaggaagccgtcgcttcagaattaaaggttacgaagaagaaggttcaacaaccactcca
tttgatatgggtgttcgaaatggcacttctcgctatcaccttgttattgatatggcttac
aaactattccagcaaggtgtcatcgacgaaaccaagcacgtttccatcacaaccgatatg
ctgcaaagactcgttgatcatcgcaactacattaaggcaaatggtgttgaccctgttgaa
attgaaaattggatttggacccgttaa

DBGET integrated database retrieval system