KEGG   Shewanella sp. MR-7: Shewmr7_3049Help
Entry
Shewmr7_3049      CDS       T00389                                 

Definition
(GenBank) transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00030  Pentose phosphate pathway
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01120  Microbial metabolism in diverse environments
shm01130  Biosynthesis of antibiotics
shm01200  Carbon metabolism
shm01230  Biosynthesis of amino acids
Module
shm_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
shm_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:shm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Shewmr7_3049
Enzymes [BR:shm01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     Shewmr7_3049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-ProteinID: ABI44033
UniProt: Q0HS72
Position
3616121..3617077
Genome map
AA seq 318 aa AA seqDB search
MANTLEQLKSYTTIVADTGDIEAIKRYQPEDATTNPSLILKAAQIPEYSALIDNAIAWAK
LQSADIEQQIDDASDKLAVNIGVEILKLVPGRISTEVDARLSFDKEKSIAKAHKLVRLYQ
EAGVDKSRILIKLASTWEGICAAKELEQEGINCNLTLLFSFAQARACAEAGVYLISPFVG
RILDWYKKDTGKDYDAVNDPGVVSVTEIYNYYKQHGYNTVVMGASFRNIGEIIELAGCDR
LTIGPSLLEELANSQVAIQPKLIPASTTVAAGEPLTEAQFRWDFNQDPMAVDKLAEGIRN
FAIDQGKLEVMLKAKLAN
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatacattagagcaactcaagtcatacactacgattgtggccgatactggcgat
attgaagcgatcaaacgctatcagccagaagacgcaacgaccaacccatcactcatttta
aaagcggctcaaattcccgagtatagcgctctaatcgacaatgctatcgcatgggctaaa
ttacaaagtgctgatattgagcaacagattgatgatgccagcgataaacttgcagtgaac
attggtgtcgagatcctaaaactggtcccaggccgtatttcgaccgaagtggatgcccgc
ttatccttcgataaagaaaaatccattgccaaagcgcataagctagtacgtctgtaccaa
gaagcgggcgtggataaatctcgcattctgattaaattagcctcaacttgggaaggcatt
tgtgccgccaaagagttagagcaagaaggtatcaactgtaacttaactctactatttagc
ttcgctcaagcacgtgcctgtgcagaagcgggcgtgtacttaatttctccattcgttggt
cgcatactcgactggtacaaaaaagacacaggtaaagactatgacgcagtaaatgacccg
ggtgttgtttctgtgactgaaatttacaattactacaaacagcatggctataacacagta
gtcatgggtgcaagtttccgtaatatcggtgaaatcatcgaattagcaggctgtgatcgc
ctgactattggcccttcattactcgaagagctggcaaactctcaagttgctattcaacct
aaactcattcctgccagcaccacagttgctgccggtgagccgttaaccgaagcgcaattc
cgctgggacttcaaccaagatcctatggctgtcgacaagttagcagaaggtatccgtaac
ttcgccatcgaccaaggcaaactcgaagtcatgctcaaggcaaaactggcaaactaa

DBGET integrated database retrieval system