KEGG   Shewanella sp. MR-7: Shewmr7_3050Help
Entry
Shewmr7_3050      CDS       T00389                                 

Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00010  Glycolysis / Gluconeogenesis
shm00030  Pentose phosphate pathway
shm00500  Starch and sucrose metabolism
shm00520  Amino sugar and nucleotide sugar metabolism
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01120  Microbial metabolism in diverse environments
shm01130  Biosynthesis of antibiotics
shm01200  Carbon metabolism
Module
shm_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:shm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewmr7_3050
   00030 Pentose phosphate pathway
    Shewmr7_3050
   00500 Starch and sucrose metabolism
    Shewmr7_3050
   00520 Amino sugar and nucleotide sugar metabolism
    Shewmr7_3050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shm04147]
    Shewmr7_3050
Enzymes [BR:shm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     Shewmr7_3050
Exosome [BR:shm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Shewmr7_3050
  Exosomal proteins of other body fluids (saliva and urine)
   Shewmr7_3050
  Exosomal proteins of colorectal cancer cells
   Shewmr7_3050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: ABI44034
UniProt: Q0HS71
Position
3617098..3618735
Genome map
AA seq 545 aa AA seqDB search
MTILTQSTTWQALAAHSHQIPHMRELFAGDPARFSNMSLSTCGLFLDYSKNRATPETLNL
LQTLAQEAKLDAKIKAMFAGDIINTTEKRAVLHTALRSTAEQSIVAEGQDIVPEVQQTLN
KMQQFVTSVTSGQWKGFTGKAITDIVSIGIGGSFLGPKIVSQALRPYWITGLNCHFVANV
DGTSISEKLKLLDPETTLFIMSSKSFGTQETLTNTLTAKAWFLAKGGSQSDVAKHFVAVT
SNVAKATDFGIDADNIFPMWDWVGGRYSLWSAIGLPIALLIGMDNFRSLLKGAHQMDTHF
ANAPLAENMPVIMGLFSLWYGNFFNAQSHVVLTYDHYLRGLPAYFQQLDMESNGKSVTLN
GTHVDYSTGPVIWGGEGTNGQHAYHQLLHQGNALIPADFIMPLQSHNPIGEHHDQLASNC
FGQTQALMQGRTLDEALAELSKSSLSDEEKLLIAKHKVMPGNKPSNTLLMDKLTPETLGA
LIALYEHRTFVQGAIWDINSFDQWGVELGKSLGNDVLARIGAEQDATALDASSNGLINLY
RQGKI
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgactatcttgacccaaagcacaacttggcaagcgttagcagcgcatagccatcagatc
ccgcatatgcgggaactctttgcaggcgatcctgcacgctttagcaacatgtcgctttct
acctgtggcttatttttagattattcaaaaaatagagcgacacctgaaacactcaactta
ctgcagacactggcgcaagaggcaaagcttgacgctaaaatcaaggcgatgtttgctggt
gatattattaacaccacagaaaagcgcgccgtgttacataccgcactgcgcagcaccgcc
gagcaatccattgttgccgaaggtcaagatatcgttcctgaagtacagcaaacgctgaac
aaaatgcagcagtttgtcacttcagtcacctcaggacaatggaaaggtttcactggcaaa
gccattaccgatatcgtcagtatcggtatcggtggctcgtttctcgggccaaagattgtt
tcccaagcattacgcccatactggattactggtttaaactgccatttcgttgccaacgtt
gatggcacctcgatcagtgaaaagcttaagctgctcgatcctgaaaccaccttatttatc
atgtcgtctaagtcttttggtacacaagagacgctgaccaataccctaacggcgaaggcg
tggttcttagccaaaggcggttcacagtcagatgtggcgaaacactttgttgccgtgacc
tctaacgtggcaaaagcgactgattttggtatcgatgctgacaatattttcccaatgtgg
gactgggttggtggtcgttattcactttggtcagccattggtttacccatagctttactc
atcggcatggataacttccgctccctattaaagggcgcccaccaaatggatacccatttt
gccaatgcgcctctagcggaaaacatgccagtgatcatggggctattctctctgtggtat
ggcaatttctttaatgctcaaagccatgtggtattaacttacgatcattacctacgtgga
cttcccgcttacttccagcaactggatatggaaagtaacggtaagtcagtcacccttaat
ggtacccatgtggattacagcacgggtcctgtgatttggggcggcgaaggaacaaatggt
cagcacgcttaccaccagctgctgcatcaaggtaacgcattaattccggcagatttcatt
atgccgctgcaaagccataatcctattggtgagcaccatgatcagttagcctctaactgc
ttcggacagactcaggcactcatgcaaggccgcaccttagatgaagcgttggccgaattg
agcaagagcagcttaagtgatgaagaaaagttacttatcgccaaacataaagttatgcca
ggcaataagccaagcaatactttgttaatggataagctgactcctgaaaccttaggtgca
ctgattgcgctctatgagcacagaacctttgtccaaggcgccatttgggacatcaactcc
ttcgaccaatggggtgttgaactcggtaaaagcttaggtaatgacgtcctcgcccgtatc
ggcgcagagcaagacgccaccgccttggatgcctcgagcaatgggttaattaacctatat
cgacagggcaaaatctga

DBGET integrated database retrieval system