KEGG   Shewanella sp. MR-7: Shewmr7_3052Help
Entry
Shewmr7_3052      CDS       T00389                                 

Definition
(GenBank) Hemerythrin HHE cation binding domain protein
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hemerythrin
Motif
Other DBs
NCBI-ProteinID: ABI44036
UniProt: Q0HS69
Position
complement(3619205..3619741)
Genome map
AA seq 178 aa AA seqDB search
MLKRLMHDHKHIAVLLNVLKNKQMKLAEGEAINFIVVRDIVEYMQGYAEHSHHPVEDIIY
AYYLAHKANDEVDKLSAEHQMVTAASSALMNTLNLILSDIVVARDKLVIDFAEYIELQEK
HMQMEEREIFPLLAKTLTDKDWLVIEQQCQASLIDDPLFLDREQQAFDELRSYLRTAE
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaagactcatgcatgatcacaaacatatagcagtgttattgaatgtcttgaaa
aacaagcagatgaaattagctgaaggcgaagctattaattttatcgtggttcgggacata
gtcgagtatatgcaaggatatgctgagcatagtcatcatcctgttgaagacattatttat
gcttactatttggcgcataaggcgaatgatgaagttgacaagcttagcgcagagcatcaa
atggttactgcagcctcctcggcattgatgaatactttgaatcttatcttgagtgacata
gtcgttgcgagggataagttagtcatcgattttgccgaatacattgagctacaagaaaag
cacatgcaaatggaagagcgggagattttcccgttactggctaaaaccttaaccgacaaa
gattggctggttattgagcagcaatgccaagcatctttaatcgatgatccgttattcctc
gaccgcgagcaacaggcctttgatgagctgcgctcttacctcaggacagccgaatag

DBGET integrated database retrieval system