KEGG   Shewanella sp. MR-7: Shewmr7_3053Help
Entry
Shewmr7_3053      CDS       T00389                                 

Definition
(GenBank) conserved hypothetical protein
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Yuri_gagarin EBP50_C
Motif
Other DBs
NCBI-ProteinID: ABI44037
UniProt: Q0HS68
Position
complement(3619963..3620688)
Genome map
AA seq 241 aa AA seqDB search
MSNSTLSLEEEVLRQEVSALYHKQALEMPSERLDQDILRLSQAHLAEMNVSPLKPAATPV
WRRFPWALSSAASLVLVVGLIVLNRGYFEEELVAPAALTMSAPMPATQAELDNAAQQAEI
AHQAREEAATQNRQREAMRSQAKMSAQENQLVESRAAPQIARALPQQDTPVMAREEALME
SLTRLQALIEAKQTQEASALVQTLQKQYPELAKVEGEATADDTQAIAKFKLLQLQLNQLS
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattccactctgtcattggaagaagaggtactacgccaagaagtctcggctttg
tatcacaagcaagcgctcgagatgccgtcagagaggctcgaccaagatattttgcgctta
tcacaagcccatttggctgaaatgaatgtgagcccgttaaagcccgctgccacgcccgtg
tggcgccgtttcccgtgggcgttatcgagcgccgcctccttagtgctggttgtgggttta
atcgtactaaatcgtggctattttgaagaggaattagtggctcctgcggccttgactatg
agtgcaccaatgccagcgactcaggctgagctagataatgctgcacaacaagcagagata
gcgcatcaagctagagaagaagccgccacacaaaatcgacaaagggaggcaatgagatca
caggccaagatgtctgcgcaggaaaatcagctagtagagtctcgagcagcaccacaaatt
gcacgggcactaccgcagcaagatacacctgtaatggctcgggaagaagctctgatggag
tctttaacacgcttacaagctttgattgaagccaaacaaacacaggaggcatctgcctta
gtgcagacgctgcagaagcaatacccagagttggcaaaagtcgagggagaagcaaccgca
gatgatacgcaagcgattgctaagtttaaattattgcaactccagttaaatcaattaagt
aaataa

DBGET integrated database retrieval system