KEGG   Shewanella sp. MR-7: Shewmr7_3068Help
Entry
Shewmr7_3068      CDS       T00389                                 

Definition
(GenBank) oxaloacetate decarboxylase alpha subunit
  KO
K01571  oxaloacetate decarboxylase, alpha subunit [EC:4.1.1.3]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00620  Pyruvate metabolism
shm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shewmr7_3068
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shm02000]
    Shewmr7_3068
Enzymes [BR:shm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.3  oxaloacetate decarboxylase
     Shewmr7_3068
Transporters [BR:shm02000]
 Other Transporters
  Primary active transporters [TC:3]
   Shewmr7_3068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 PTS_EIIA_1 MatP_C
Motif
Other DBs
NCBI-ProteinID: ABI44052
UniProt: Q0HS53
Position
complement(3638065..3639900)
Genome map
AA seq 611 aa AA seqDB search
MNRVNSIVASKPLQLTDVVLRDAHQSILATRLRIDDMLPIAPLLDKVGFWSLESWGGATF
DACIRYLGEDPWDRIRELKKLMPNTPQQMLLRGQNLLGYRHYADDLVTRFVERAHAYGVD
VFRIFDAMNDVRNLEMAVKAVRDVGGHAQGTISYTTSPVHTVDTWVDMAKRLEDMGCHSL
CIKDMAGLLKPMEAFELISRLKSQTQLMLSLHCHATTGLSTATYQKAIEAGIDVLDTAIS
SMSQTYGHTATETVVAMVAETERETHYDLALLEEIAAYFREVRKKYAKFEGALKGIDSRI
LRAQVPGGMLTNMESQLKEQGAADKLDAVLEEIPKVRQDLGFLPLVTPTSQIVGSQAVIN
VLMGQRYQSLTKETEGVLRGEYGATPAPVNPELQARVLNGATAITCRPADLLAPELDKLR
TELLSKAQEQGISLVSESKEKSQDDDLLIYALFPQIGLQFLKSRHDPSAFEPKPELAPVL
SATPREAEIYTVTVEGQTYVVEVAEGGEISQIQAQGQAALPLGQAYPSQPSTAPVPQTSE
VKLKMSAPLSGNIFKVHVAIGDKVCAGDVVIILEAMKMETEIRAQGDGIITHLFVKEGDS
VAVGSQLLALA
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgagtaaattcgattgtggcgtctaagccattacagttaaccgatgtcgttttg
agggatgcacatcagtctattttagcgacgcgtttacgcattgatgacatgcttccgatc
gcacctctgctcgataaagtgggtttttggtcgctcgagtcttggggcggagcaaccttc
gatgcctgtatccgttatttaggtgaggatccttgggacaggatccgcgagctgaaaaaa
ttgatgcccaatacaccgcagcaaatgttactgcgcggtcaaaacctattaggttatcgc
cattatgctgatgatttagtgacacgttttgtcgagcgtgcccatgcctatggtgtggat
gtgttccgtatctttgatgcgatgaatgatgtgcgtaaccttgagatggcggtaaaagcg
gtgcgtgacgtcggtgggcatgcacaaggcacaatttcttatacaactagccctgttcat
acggttgatacttgggtcgatatggcaaagcgtcttgaggacatgggctgccattcgctg
tgcattaaagacatggcgggcctactcaagccgatggaagcctttgagctaattagtcgc
ttaaaatcacaaactcaactcatgctatcactacattgtcacgcaacgactggactgagc
actgcaacctatcaaaaggcgatagaggcgggaattgatgtgctcgatactgctatttcc
tccatgagccaaacctatggccatacggcaactgaaaccgtggttgccatggtggcggag
accgagcgtgaaactcactatgaccttgccttactagaagagattgccgcctatttccgt
gaggtgcggaaaaagtacgccaagtttgaaggggcattgaagggcattgattcgcgtatt
cttcgcgctcaagtgcccggtggcatgttgactaacatggagagccaacttaaagagcaa
ggtgcagccgataagctcgatgctgtgctggaggagatcccaaaggtgcgtcaggatttg
ggctttctgcctttggttacaccaacctcgcaaattgttggctcgcaagccgttatcaac
gtactgatggggcaaagatatcaatcgttgaccaaagagactgaaggcgtgttaaggggc
gaatatggtgctactccggctcctgttaatcccgagttgcaggctcgagtgcttaacggt
gcgacagcgatcacctgccgtcctgcggatttactcgcacccgagttggacaaactgcgt
acggagttattatcaaaggcgcaggagcaagggattagtctcgtctcagagagcaaagaa
aagtctcaggacgatgacttactcatctacgcactgttcccgcagattggcttacagttt
ttaaagagtcgtcacgatccctcggcctttgagccaaaacctgaacttgcgccagtgtta
tctgctacgccgcgtgaggccgagatttatacagtcacggttgaggggcaaacttatgtg
gttgaggttgccgagggcggcgaaattagccagatccaagctcaggggcaagccgcactg
ccgcttggtcaagcttatccttctcagccgagcactgcgccagtgcctcaaaccagtgag
gtgaaacttaagatgagcgcgcccctatcgggcaatatctttaaagtgcacgtggccata
ggtgacaaggtttgcgccggagatgtggttatcatccttgaggcgatgaaaatggagaca
gaaattcgcgctcagggggatggcattatcacccacctctttgtgaaagaaggggattcg
gttgccgtgggttctcaattactggccttagcctag

DBGET integrated database retrieval system