KEGG   Shewanella sp. MR-7: Shewmr7_3073Help
Entry
Shewmr7_3073      CDS       T00389                                 

Definition
(GenBank) protein of unknown function DUF152
  KO
K05810  polyphenol oxidase [EC:1.10.3.-]
Organism
shm  Shewanella sp. MR-7
Brite
Enzymes [BR:shm01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.-  
     Shewmr7_3073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cu-oxidase_4
Motif
Other DBs
NCBI-ProteinID: ABI44057
UniProt: Q0HS48
Position
complement(3650934..3651722)
Genome map
AA seq 262 aa AA seqDB search
MLRHDWPVPDNVAIAMTDRHGGVSLAPYDSLNLGLHVGDAPQQVLANRGILAKQLCLATE
PVWLEQVHGTQVVDLADITPINLAQEAQSESVALQDSPPLVADASYTHLVGRVCVVMTAD
CLPVLLCNQQGTEVAAAHAGWRGLCDGVIETTVAKFASKPSELIAYLGPAIGPKTFEVGA
EVRAAFMATDPNAANCFVAQCQSTKPDKYLADIIGLAKLCLKKLGITQIYSADICTVSSP
DYFSYRRDKITGRMASLIWIKS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtcacgattggcctgtaccggataatgtggcaattgcgatgactgaccgccac
ggcggtgtgagtctcgcgccctacgatagcctgaacttagggctgcatgtgggggatgcg
ccgcagcaggtattggctaatcgtggtattttggcgaagcagttatgccttgcgactgag
cctgtgtggttggagcaagtccatggcactcaggtggttgatttggccgatatcacccca
atcaatcttgcccaagaagctcaatcagagagtgttgccttgcaagattctccacctttg
gttgccgatgccagctatacccatcttgtcggacgggtgtgtgtggtgatgaccgccgat
tgtttaccagtacttctgtgtaatcaacaaggtactgaagttgccgctgcccatgccggc
tggcgcggactctgtgatggtgtgattgagacgacagtggctaagtttgcctctaagcca
agcgagctgattgcttatctagggccagcaattgggcccaagacctttgaggttggcgcc
gaggtgcgtgctgcctttatggcaacagatccaaacgccgcaaactgctttgttgctcaa
tgtcagtcaactaagccagacaaataccttgccgatattatcggattagccaaattatgc
ttaaagaaacttggcattacgcagatctacagcgccgatatctgcactgtctctagccct
gattatttctcttatcgtcgtgataaaatcactggccgcatggcttcattgatctggatt
aagtcttaa

DBGET integrated database retrieval system