KEGG   Shewanella sp. MR-7: Shewmr7_3076Help
Entry
Shewmr7_3076      CDS       T00389                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer
  KO
K03406  methyl-accepting chemotaxis protein
Organism
shm  Shewanella sp. MR-7
Pathway
shm02020  Two-component system
shm02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:shm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Shewmr7_3076
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Shewmr7_3076
Bacterial motility proteins [BR:shm02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Shewmr7_3076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal 4HB_MCP_1 HAMP KASH_CCD DUF812 IFT57 Arfaptin ISG65-75 Fib_alpha Serine_rich
Motif
Other DBs
NCBI-ProteinID: ABI44060
UniProt: Q0HS45
Position
3654314..3655939
Genome map
AA seq 541 aa AA seqDB search
MNGLQIKQKMFIGILVPLVMLLTIGFIAINMMGKIEYGVERIYNDRVVPLDDLKVIADKY
AVDVIDAVNKANAGGISASETINALDSAKSIVDQRWHKYLATELTKEESQLAQQAERLFI
PANGQIEQLIAYLRGVNGDVVHKLNDKILPLYQAIDPISGKVSELIDLQIKIAGQERDSV
KSIYQSSISIFIILAGMAMLISIVIGLWVNRSVMNPIRDIVQNLKIIRQDSDLTVKFKTF
NDDELGQISTSLTQVIEHLRGILHSIAEAANTVNSSATELGSFTQETNKRMQQQQAETEQ
TATAMNEMTATVAEVAQSAAAAADSAKDADNYAANGNHIVMQSITSMSQLSEQIQKTAQV
IGFLSNESQNIGRVLDVIKSIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRTLAQRT
QKSTQEIEAMIATLQQGVKEAVNAMEVGINQVDDANDKANQAGQALKEIVASVDNITELN
THIATAAEEQSSVAESINRSIIAISDISEHSTNSALELSESVMNLTKLANSMRNQVSAFR
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtcttcaaataaaacaaaagatgtttattggcattctcgtgccacttgttatg
cttctaactatcggttttatcgctatcaacatgatgggaaaaatcgaatatggtgtcgaa
cgtatctataacgaccgagtcgtccccctcgatgatcttaaagttattgcggataaatat
gccgtcgatgtgattgatgcggtgaacaaagccaatgctggcggtattagtgcttcagaa
actatcaatgcactcgatagcgccaaatccattgtagatcaacgctggcataagtatctc
gccacagagctcaccaaagaagagtctcaactcgcgcaacaagccgaacgtttattcatt
cccgccaatgggcaaatagaacaattaatcgcttatctcagaggagttaatggtgatgtc
gttcataagctgaatgacaaaatattgcctctatatcaagccatagaccctatcagcggt
aaagtctccgaacttatcgatctacaaattaagattgctgggcaagaaagagatagcgta
aaaagtatctatcaatcatccatttccatatttattattctcgcagggatggcaatgctg
atcagcatagtgattggactctgggtcaatcgcagtgtgatgaatcctattcgcgatata
gttcaaaacctgaaaatcattcggcaagactcggatctcacggtgaagtttaaaaccttc
aacgatgatgagctcgggcagatatccactagcctcacccaagttatcgagcacttacgg
gggatcttacactctatcgccgaagccgcgaatacggtgaatagctcggccactgagtta
ggtagttttacccaagaaaccaacaaacgcatgcagcagcaacaggcggaaaccgaacaa
accgccacagccatgaatgagatgacggccacggtcgccgaggtggctcaaagcgccgcc
gcagcagcggattcagctaaggatgccgataattacgcagccaatggtaatcacattgtg
atgcagtccatcaccagcatgtcgcaactttctgagcaaattcaaaaaacggcgcaagtg
attggctttttatccaatgaaagtcaaaacatcggccgagtattagatgtgatcaaaagc
attgccgaacaaaccaatctactggcactcaatgcagccattgaagccgcccgcgccgga
gagcaaggccgaggctttgcggtggtcgccgacgaagtccggacattggcgcagcgcacc
caaaaatcaacccaagaaattgaagcgatgatcgccactctgcagcaaggagttaaagaa
gccgtgaatgcgatggaagtggggatcaatcaagtcgatgatgccaacgataaggcgaat
caagctggtcaagctttaaaagagattgtcgcgtccgtcgataacatcactgagctaaat
acccatatcgctacggctgccgaggagcaaagtagcgtcgccgagagcataaaccgtagc
attattgccattagcgatatttccgaacactccacaaattcggccttagagttgagtgag
tcggtgatgaatctgactaagcttgccaacagtatgcgtaatcaggtgagtgcattcaga
ctctag

DBGET integrated database retrieval system