KEGG   Shewanella sp. MR-7: Shewmr7_3078Help
Entry
Shewmr7_3078      CDS       T00389                                 

Definition
(GenBank) Pseudouridine synthase, Rsu
  KO
K06183  16S rRNA pseudouridine516 synthase [EC:5.4.99.19]
Organism
shm  Shewanella sp. MR-7
Brite
Enzymes [BR:shm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.19  16S rRNA pseudouridine516 synthase
     Shewmr7_3078
Ribosome biogenesis [BR:shm03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    Shewmr7_3078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 IlvN
Motif
Other DBs
NCBI-ProteinID: ABI44062
UniProt: Q0HS43
Position
complement(3657401..3658126)
Genome map
AA seq 241 aa AA seqDB search
MQSKRGRLDRYLAVKLQIHRKAVRELLLAERVYVDGAPAKALDLLVDEFSHIVFDGQVLQ
ANQPVYLMLYKPVGVVSATKDKEHRTVIDLLDCDTRQELHIAGRLDLNSSGLLLLTNDSR
WSEALMSPEQKVDKVYRVTLANPLSDEYIAAFAQGMYFGFEDITTQPAKLVILAPHVAEV
TLREGKYHQIKRMFGRFRNPVLGLHRLSIGEITLDEALKPGESRMLTAQEVASIYLTTKP
D
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcaaaacgcggtcgtctcgatagataccttgccgttaagctacaaattcaccgt
aaagccgtgcgagaactcttgttggcggagcgagtgtatgtggatggcgcgcctgcgaaa
gcgctcgatctgctggtggatgaattttcccacatagtgtttgatggacaagtcttacag
gccaaccagcctgtgtatcttatgctgtataagcccgttggcgtggtgagtgcaaccaaa
gacaaagagcatcgcactgtcattgatttgctcgattgcgatactcgccaagagctgcat
attgcgggtcggttagatttaaactcttcgggcttattgctgctgaccaatgatagccgt
tggtccgaggcgctcatgtcgccagagcaaaaagtggataaagtgtatcgggtgactctg
gcaaatcctttgagcgatgagtatatcgcggcatttgcacagggcatgtattttggcttt
gaagatatcactactcagccggcaaagcttgttatcctcgcccctcacgttgcagaggtg
accttaagggaaggtaaataccatcaaatcaagcggatgtttggccgttttcgtaaccct
gtgctgggattacaccgactttctatcggtgagattaccctagatgaagccttaaaaccg
ggcgagagtcgtatgttgacggcgcaggaggtcgcatctatctatcttacgacgaagcct
gattag

DBGET integrated database retrieval system