KEGG   Shewanella sp. MR-7: Shewmr7_3080Help
Entry
Shewmr7_3080      CDS       T00389                                 

Definition
(GenBank) NADPH-dependent FMN reductase
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2
Motif
Other DBs
NCBI-ProteinID: ABI44064
UniProt: Q0HS41
Position
3658908..3659522
Genome map
AA seq 204 aa AA seqDB search
MNLLIISTSQRANSQSAKVARYIAETSFLSPHSVGYDAIHHLELCQFNLPFWDGEEDNKG
EHWPEIERRVDAADALVLITPEWGGMASPLLKNFLLMCSRQETAHKPVLLISVCSGISGA
YPIVEVKMNALKNNKLVPIPDHLIIRNVENVLNATPQGTRDINLRERVQYSLFMLHQYAQ
ALAPIRQRHIHQPYPKQQEYCYGM
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaacttactcatcatcagcaccagtcaaagagccaactcgcaaagcgctaaagtcgcg
agatatatagccgaaaccagttttttatcgccccatagtgtcggttacgacgctatccat
catttagaactttgccagttcaatctgccattttgggatggtgaagaggacaacaagggc
gaacattggcctgagattgagcgaagagtcgatgcggcagatgccttggttttgatcacg
cccgaatggggtggaatggcatcgccactgcttaaaaacttcctgctgatgtgtagccgc
caggaaaccgcccataagccagtgttgctgatttcagtttgcagcggcattagcggagct
taccccattgtggaagtcaaaatgaatgctctcaaaaacaataaattggtgcccattccc
gaccatttgatcatccgtaatgtcgagaatgtactcaacgccacgccccaaggtacgcgg
gatatcaacctcagggaaagagtgcaatacagcctgtttatgttgcatcaatacgcccaa
gccttagcaccgatacgccaacgccatattcatcaaccctaccccaagcagcaggaatac
tgctacggtatgtaa

DBGET integrated database retrieval system