KEGG   Shewanella sp. MR-7: Shewmr7_3082Help
Entry
Shewmr7_3082      CDS       T00389                                 

Definition
(GenBank) conserved hypothetical protein
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YcxB
Motif
Other DBs
NCBI-ProteinID: ABI44066
UniProt: Q0HS39
Position
3660134..3660604
Genome map
AA seq 156 aa AA seqDB search
MTTPYCYSTTYILDKAHFDECYTQSVKPDPTLRPYYKAMGFGLMGIALIFTDISLYLAYF
FVGLGVIEALNVKYNKAWWLMRQMMSKAANNEVTLVVDEQGISTQSQYVKSQIHWTDIFR
IVQTEKGFLITHKTGTSYISNRSLDEACTAFIKTKI
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaccttattgttattccacaacttatatcttagataaagcgcattttgacgag
tgttatacccagtcagtcaagcccgatcccacactcagaccttactataaagccatgggg
tttggtcttatggggattgcactgatttttacggacatcagcctctatctggcctatttc
tttgtcggacttggggtaattgaagcgttaaatgtgaaatacaacaaagcttggtggttg
atgcggcagatgatgagtaaggccgccaataatgaagtcacgctggttgtagatgagcaa
gggattagcacccaatcacaatacgttaaaagccagatccactggacggatattttccgt
attgtgcaaactgaaaagggctttctaatcacccataaaaccggtactagctatatttct
aaccgcagcttagatgaggcctgcactgcatttataaagaccaaaatctaa

DBGET integrated database retrieval system