KEGG   Shewanella sp. MR-7: Shewmr7_3084Help
Entry
Shewmr7_3084      CDS       T00389                                 

Definition
(GenBank) conserved hypothetical protein
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABI44068
UniProt: Q0HS37
Position
3661983..3662219
Genome map
AA seq 78 aa AA seqDB search
MKTLSAVITLSALMSFAAFADESTLPPAPANDIAQLTEVCQQMASEDQVENAELKQYVLD
CVNDQLTEMGYQTVKELN
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgttatcagctgttatcacactctcggcacttatgagtttcgcagcctttgcc
gatgaatcgacacttcctcctgcacctgcaaatgatatcgctcaactgacagaagtgtgc
caacaaatggcctctgaagatcaggtcgaaaatgccgagcttaagcaatatgttctcgac
tgcgtgaacgaccaactcacagaaatgggctatcaaaccgtcaaagagcttaactga

DBGET integrated database retrieval system