KEGG   Shewanella sp. MR-7: Shewmr7_3085Help
Entry
Shewmr7_3085      CDS       T00389                                 

Definition
(GenBank) MltA-interacting MipA family protein
  KO
K07274  MipA family protein
Organism
shm  Shewanella sp. MR-7
Brite
KEGG Orthology (KO) [BR:shm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shm02000]
    Shewmr7_3085
Transporters [BR:shm02000]
 Other Transporters
  Others
   Shewmr7_3085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MipA
Motif
Other DBs
NCBI-ProteinID: ABI44069
UniProt: Q0HS36
Position
3662573..3663436
Genome map
AA seq 287 aa AA seqDB search
MYRTLFILLTALSLPSIGMAKEPCVTKDECIEMRNWDLGVAVGWGQKTNPLRDFDDIPVF
FIPTVAYYGEHWFFDNGNLGFSLTEQKYFSLNLVTSYSLDRAYFYRWDPSNIFLKRSSQE
EARLLATNTALSTEPDPVFNSLESRNFTMLGGAEAFIYSPLGVVRLAYTHDMFNVHQGAE
AQIKWTYGWHLTHWVMDMSLVFDWKSTNVVDYYYGVRPSENAYWSQHYHADAGWNKGIEM
TARYILTDNWDMLFAFRYTQLADEIAASPLLDEDYSSTYFIGAAYRF
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgaacactgtttatcttactcaccgcacttagcctgccttcaataggaatggcg
aaggaaccgtgcgtcactaaagatgaatgcatcgaaatgcgtaactgggatttaggcgtg
gcggtcggctggggacaaaagaccaatccactgcgggattttgatgatattccagtcttt
tttatccctaccgtagcttactatggtgaacattggttttttgataacggtaacttaggt
ttcagcttaaccgagcagaaatacttcagtttaaacttagtgaccagctatagcttagat
agagcctacttttaccgctgggatccatcgaacatcttcctgaaacgcagctcacaggaa
gaggcaagactgctcgccaccaatactgccctcagcactgaacccgatcccgtgtttaac
tccttagaatcgcgaaactttaccatgctgggcggcgcagaagcctttatttatagcccg
ttaggtgtagttagattagcctacacccatgatatgtttaatgtgcaccaaggcgccgaa
gcgcaaataaaatggacctatggctggcatttaacccactgggtcatggatatgtcgctc
gtgtttgattggaaaagtactaatgtcgtcgactattactatggtgtacgtccgagtgaa
aatgcttattggagccaacattaccatgcagatgctggttggaataaagggatagaaatg
acggcccgttatatcttaactgataactgggatatgctttttgcgtttcgctatacacaa
cttgcagatgaaattgccgccagccccttgctcgatgaagactatagcagcacatatttt
attggcgcagcgtataggttttga

DBGET integrated database retrieval system