KEGG   Shewanella sp. MR-7: Shewmr7_3087Help
Entry
Shewmr7_3087      CDS       T00389                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K02483  two-component system, OmpR family, response regulator
Organism
shm  Shewanella sp. MR-7
Brite
KEGG Orthology (KO) [BR:shm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:shm02022]
    Shewmr7_3087
Two-component system [BR:shm02022]
 OmpR family
  Unclassified
   Shewmr7_3087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg Rhomboid_N
Motif
Other DBs
NCBI-ProteinID: ABI44071
UniProt: Q0HS34
Position
3663855..3664568
Genome map
AA seq 237 aa AA seqDB search
MTNPQSPHRVLLVEDDVRLANLIVDYLKSHGMHVEVERRGDTVLTRLINYKPDIILLDIM
LPGIDGLSLCEKLPDYFAGPILLMSALGSSEDQIKGLELGADDYVVKPVDPALLVARINN
LLRRQNQPPQAESHCLTFGKLSIDPHTHAIRLDNKEVDLTSHEFELLWLLASQAGQVLSR
QYIYQLLLNIDFDGKDRKIDVRISRLRKKLNDNIETPFRIKTVWGQGYLFAPEAWNN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatccacaatcaccccacagagtgttattggttgaagacgatgtccgtcttgcg
aatttaatcgtagattatttgaaatcccacggcatgcatgttgaagtcgagcgccgtggt
gacacagtcctaacccgcttaatcaactacaagcccgatatcatactgttagacattatg
ttgccaggtatcgatggcctaagcctgtgtgaaaagctacccgattactttgctggcccc
atcctactgatgagcgctctaggttcgagcgaagatcagatcaaaggtttagagctcggc
gccgacgactatgtcgttaaacccgttgacccagcgctgctcgtcgcccgtataaacaac
ctattacgtcgccaaaatcaaccgcctcaggccgaatcccattgcctgacctttggtaag
ctgagtatcgatccccatacccatgctatccgccttgacaataaagaagtcgatctcacc
agccatgagtttgaactcctctggttactggcctcacaggcaggacaagtgctgagccgt
cagtacatctatcaattactgcttaacattgattttgatggtaaagatagaaagatagac
gtgcgcatttcaagactgcgtaaaaaactgaacgacaatatcgagacccccttcagaatt
aaaaccgtctggggacagggttatctcttcgcccccgaggcttggaacaactaa

DBGET integrated database retrieval system