KEGG   Shewanella sp. MR-7: Shewmr7_3090Help
Entry
Shewmr7_3090      CDS       T00389                                 

Definition
(GenBank) conserved hypothetical protein
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4136
Motif
Other DBs
NCBI-ProteinID: ABI44074
UniProt: Q0HS31
Position
3666342..3666869
Genome map
AA seq 175 aa AA seqDB search
MGYKNIASLFVALVLVSACSSKPKNDYDLNYDFKALQSFSQLAPQPSDDPLSAQRIQTEI
TQQLSQKGFTENATSPDFKVAYGLLTQDKPKDSGLSIGLGTGSSGGIGVGTSVGVPLGSD
TAKIQTIQIDIIDTKTNKLIWRGTDSFDFDGGGDKKAQDTAKAVSRILAQFPPQP
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggatacaaaaatatcgccagtctgtttgtcgccttggtcttagtcagcgcctgcagc
agtaagccgaaaaacgattacgatctcaattacgactttaaggcattacagagtttcagc
cagctcgctccccaacctagcgacgacccactcagcgcccagcgcattcaaaccgaaatc
acccaacaattaagccaaaaaggctttaccgaaaatgccacttcccccgattttaaagtc
gcctatgggttattaacccaagataaacctaaagactcgggtttatccataggtttaggc
acgggcagttctggcggcattggcgtaggcacaagcgtcggcgtaccacttggcagtgac
acggcaaaaattcaaaccattcaaattgatattatcgatactaaaaccaataagctgatt
tggcgcggcacagatagtttcgattttgacgggggcggcgataaaaaagcccaagacaca
gccaaagccgttagccggattttggcgcagtttccaccgcagccataa

DBGET integrated database retrieval system