KEGG   Shewanella sp. MR-7: Shewmr7_3095Help
Entry
Shewmr7_3095      CDS       T00389                                 

Definition
(GenBank) sulfate ABC transporter, ATPase subunit
  KO
K02045  sulfate transport system ATP-binding protein [EC:3.6.3.25]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00920  Sulfur metabolism
shm02010  ABC transporters
Module
shm_M00185  Sulfate transport system
shm_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:shm00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Shewmr7_3095
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Shewmr7_3095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shm02000]
    Shewmr7_3095
Enzymes [BR:shm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.25  sulfate-transporting ATPase
     Shewmr7_3095
Transporters [BR:shm02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfate transporter [MD:M00185] [OT]
    Shewmr7_3095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE_3 AAA_21 SMC_N AAA_22 AAA_18 AAA_16 NACHT AAA AAA_29 AAA_23 SbcCD_C TniB AAA_5 MMR_HSR1 T2SSE AAA_24 RsgA_GTPase AAA_33 AAA_30 MIT_C cobW NB-ARC
Motif
Other DBs
NCBI-ProteinID: ABI44079
UniProt: Q0HS26
Position
3671084..3672214
Genome map
AA seq 376 aa AA seqDB search
MSIRLTNISKKFGQFQALSPLNLDIQEGEMIGLLGPSGSGKTTLLRIIAGLEGADSGQIH
FGNRDVTQVHVRDRRVGFVFQNYALFRHMTVADNVAFGLEVIPKNQRPSKAEIQKRVSHL
LEMVQLGHLAQRYPEQLSGGQKQRIALARALATQPEVLLLDEPFGALDAKVRKELRRWLR
SLHDELKFTSVFVTHDQDEALELSDRVVVMSNGHIEQVNTPIELYAQPNSRFVFDFLGNV
NRFEASWQQNRWTNGDAFLVPPEQVPLQQNGALYVRSHELALADKPNSQAHIPFTIVAIT
PVGAEVRVELAPIGWQSEELWEATFTHHHLQELGLQKGSVVYATPRTAYFFGEQSDGSPI
RQSWPFLPPGSLAFDI
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagtattcgtttaactaatatttccaaaaaatttggccaatttcaggcgctctcgccg
ctcaatctcgatattcaagaaggcgagatgataggtcttctcggcccttccggctcgggt
aaaaccaccctattgcggattattgccggccttgaaggcgctgatagcggccaaatccat
ttcggtaatcgcgatgtgactcaagtgcatgtgcgtgaccgcagagtggggtttgtgttt
caaaactacgccctgttccgccatatgacggtcgccgataacgtcgcctttggactcgaa
gtcattccgaaaaatcagcgcccctctaaggccgaaatccaaaagcgcgttagccattta
ctcgaaatggtgcaactgggccatttagcccagcgctaccctgagcagctttcgggcgga
caaaaacagcgtatcgccttggcccgcgccttagcgactcagcccgaagtgctgttactc
gacgaaccctttggcgccctcgatgccaaggtgcgtaaagaactgcgccgctggttgcgc
agccttcacgatgagctgaaattcactagcgtgtttgtgacccacgatcaggacgaagcc
ttagagctttccgatagagtggtggtgatgagcaacggccatattgaacaggttaatacg
cccattgagttgtatgcccagcccaatagccgctttgtgtttgatttcttgggtaacgtc
aatcggtttgaagcaagctggcaacagaatcgttggaccaacggtgacgccttcttagtg
ccgccagagcaagtgccactgcaacaaaacggcgcgctctatgtgcgtagccacgagctg
gcactggcggataaacccaacagccaagcccatattccctttaccatagtggcaataaca
ccagttggagcagaagtgcgcgtcgaactcgcgcctatcggctggcagagtgaagaactg
tgggaagccacctttacccaccaccatctgcaagaattaggactgcaaaaaggcagtgtg
gtctacgccaccccaagaacggcttatttctttggagaacaaagtgatggctcgcctatt
cgtcaaagctggcccttcctcccaccgggcagcttggccttcgatatttaa

DBGET integrated database retrieval system